KEGG   Coturnix japonica (Japanese quail): 107316717Help
Entry
107316717         CDS       T04297                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00250  Alanine, aspartate and glutamate metabolism
cjo00410  beta-Alanine metabolism
cjo00430  Taurine and hypotaurine metabolism
cjo00650  Butanoate metabolism
cjo01100  Metabolic pathways
Module
cjo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107316717 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107316717 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107316717 (GAD1)
   00430 Taurine and hypotaurine metabolism
    107316717 (GAD1)
Enzymes [BR:cjo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107316717 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 107316717
NCBI-ProteinID: XP_015724026
LinkDB All DBs
Position
7
AA seq 590 aa AA seqDB search
MASSAPSSSNDAPDPAPTNLRPTTYDSWCGVAHGCTRKIGLKICGFLQRTNSLEDKGRIV
GSLKERQSSKNLLACENSEREARFRRTETDFSNLYARDLLPAKNGEEQTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDMIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTQKQSHYSIKKAGAALGFG
TDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLFVNATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSXKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGIL
QGCNQMCAGYLFQQDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQVNKCL
ELAEYLYTKIKNREEFEMVFEGEPEHTNVCFWYIPPSLRGMPDCDERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgctccctcgtcctccaacgacgctccggaccccgccccaaccaattta
cgacccacaacctacgactcgtggtgcggcgtggcgcacggatgcaccaggaagatcggc
ctgaagatatgcgggttcctgcagaggaccaacagccttgaagacaaaggccggatcgtg
ggctccttgaaggagcggcagtcctccaagaacctgctggcgtgcgagaacagtgagcgg
gaagcccggttccgccgcaccgagacggacttctccaacctttatgcccgagatttgctg
cccgctaagaatggcgaggagcagacaatgcagttcctgctggaggtcgtggacatactc
ctcaactacgtgaggaagacgtttgacagatccaccaaagtgctggacttccaccatccg
caccagctgctggagggcatggagggcttcaacctggagctatcggacaaccccgagtcc
ctggagcagattttggtggactgccgggatacgctcaagtacggggtgcggacaggtcac
ccgcgcttcttcaatcagctatccacggggttggacatgatcggcttggcaggggagtgg
ctgacatccaccgctaacaccaacatgtttacatatgaaattgcccctgtttttgtcctc
atggaacaaataacacttcgaaagatgagagagattattggatggtcaaataaagatggt
gatggaatattctcacctggaggagccatctccaacatgtacagcataatggccgcacgc
tacaaatatttccctgaagtcaaaaccaaaggcatggctgcagtccctaaactggttctc
tttactcagaagcagagtcactactcaataaagaaagctggagctgcacttggatttgga
acagacaatgtaatcttgataaagtgcaatgaaagaggcaaaataataccagctgattta
gaagcaaaaattttggaagcaaaacaaaagggatatgttcctctctttgtaaatgcaact
gcgggcacaacagtttatggagcctttgatccaatacaggagattgcagatatatgtgaa
aaatacaacctctggcttcacgtagatgctgcttggggaggtggactcttaatgtcctga
aagcatcgtcataaactgaatggaatagaaagagccaattcagtcacttggaatccacac
aagatgatgggagtattgttgcagtgttctgccattctggtccgggagaagggtatactt
caaggctgcaatcaaatgtgtgcaggatatcttttccagcaggacaaacagtatgatgta
tcctatgacactggagataaggcaatacagtgtggccggcatgtggacattttcaaattc
tggttgatgtggaaggcaaagggtacagtgggatttgaaaatcaggtcaacaaatgcctg
gaactggcagaatatctctatactaaaataaaaaacagagaagaatttgagatggttttt
gaaggagagccagagcacacaaatgtatgtttttggtatattccaccaagtctcagaggc
atgccagactgcgatgagagacgagaaaagctgcacagggtggcaccgaaaatcaaagcc
ctgatgatggagtcaggtactaccatggttggatatcagcctcagggcgataaagtcaac
ttcttccgaatggtcatctcaaacccagcagcaactaagtctgacatagacttcctcatt
gaggaaatagagagattggggcaggagctgtag

DBGET integrated database retrieval system