KEGG   Coturnix japonica (Japanese quail): 107316995Help
Entry
107316995         CDS       T04297                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00500  Starch and sucrose metabolism
cjo01100  Metabolic pathways
cjo04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107316995 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    107316995 (GYS2)
Enzymes [BR:cjo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     107316995 (GYS2)
Glycosyltransferases [BR:cjo01003]
 Polysaccharide
  Storage polysaccharide
   107316995 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 107316995
NCBI-ProteinID: XP_015724656
LinkDB All DBs
Position
1
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLIGPYFEHNVKTQVEVCEPPNPAIKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDRWKGEFWDATNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPNVIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAANIDFYNNLDQFDIDKEAGERQIY
HRYCMERAAVHCAHVFTTVSQITAIEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFSLENTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKSD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLSKI
LDRDDITIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVIVHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPCAPPKTEGFRFPRPSSVPPSPSVSQHSSPHHSEG
EDEDEDERYDEDEEAERDRQNIKSPFSLGVLPQGKKKQHGEFRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcgagatcactgtccatgacctctctgaatgggcttcctcagtgggaagat
gaagacctgccagtggaggacttgttgctctttgaagtttcttgggaagttaccaacaaa
gtgggaggaatttatacggtgatccagacaaaagccaaaattacagcagatgaatggggt
gaaaactattttctgattggtccttattttgagcacaatgtgaagacacaggtggaagta
tgtgagcctccaaaccctgcaattaagaaggcaatggataccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactgtttgatata
ggatcagcagcctggaatctggacagatggaaaggcgaattttgggatgctaccaacata
ggaatcccttttcatgaccgagaagccaatgatgctgtaatttttggatcattaacagcc
tggtttttaaaagagctttcctgtcagtttgatgacaagcccaatgtaattgctcatttc
cacgaatggcaggcaggagtgggtttaatactgtctcgatctcagaaacttccagttgcc
acaatttttactacccatgccaccctgcttgggagatacctgtgtgcagccaatatagac
ttttacaacaatcttgaccagtttgacattgacaaggaagcaggggagagacagatttac
catcgatattgtatggaacgggcagccgtacactgtgcccatgtgttcaccacagtctca
cagataacagcaattgaagcagaacacatgcttaaaagaaatcctgatgttgtcactcca
aatggcttgaacattaagaagttttcagcaatgcatgaatttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggccatttctatggacaccttgacttcagt
cttgaaaataccttatttttcttcattgctgggagatacgaattttccaacaaaggagct
gatatgtttctagaagccttatcaagactaaactttttgctgagggtacataagagtgat
gttacagtcgtcgtgttcttcattatgccagcaaagacaaacaatttcaatgtggaaacc
ctgaaaggacaagcagtccggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaagaaactctacaatgccttactaaaaggagaaattccagacttgagcaagatt
cttgaccgggatgatataaccattatgaaaagagccatcttttcaactcagcgacactgt
ctgccaccggtgaccacccacaacatgattgacgatggcaatgatccaatactcaacacc
atccgacgtattggccttttcaacaaccgaacagacagagtaaaggtgatcgtacatcca
gagtttctttcttcaacaagcccgttgctgcccttggactatgaagaatttgtcagaggt
tgtcacttgggtgtatttccgtcatactatgaaccctggggttacactccagctgaatgt
actgtgatgggtattcccagtgtgaccacaaacctttctggatttggctgtttcatgcag
gaacacgttgctgacccagctgcttatggcatctacatagttgacaggaggttccgctca
cctgatgaatcatgtaaccagctgactcagttcctgtatggattttgtcagcagtcccgt
cgccagaggatcatccaaagaaaccgaactgaaaggctctcagatctgttggactggaga
tacctaggcaggtattatatgcatgctagacacttggccctcagcagaacattccctgat
aaatttgagatggaaccatgtgctccaccaaagacggaaggtttcagattcccaagacct
tcatcagtgccaccatcaccttctgtctctcagcattccagccctcaccatagcgaaggt
gaggatgaagatgaagatgaaagatatgatgaggatgaggaagctgaaagggataggcaa
aatatcaagtctccattttcactgggagtattgccacaaggaaagaagaagcagcatgga
gagttcaggaactga

DBGET integrated database retrieval system