KEGG   Coturnix japonica (Japanese quail): 107317186Help
Entry
107317186         CDS       T04297                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00500  Starch and sucrose metabolism
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107317186
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     107317186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 107317186
NCBI-ProteinID: XP_015725023
LinkDB All DBs
Position
8
AA seq 512 aa AA seqDB search
MRVLLLLVAVGLCQAQYNPNTQPGRTSIVHLFEWRWADIAQECERYLAPNGFGGVQVSPP
NENIVITNPNRPWWERYQPISYKICSRSGNENEFRDMVTRCNNVGVRIYVDAVVNHMCGS
MGGTGTHSTCGSYFNTGSRDFPAVPYSAWDFNDGKCHTASGDIENYGDMYQVRDCKLSSL
LDLALEKDYVRSTVAAYMNRLIDMGVAGFRLDAAKHMWPGDIRAFLDKLHDLNTQWFSAG
TKPFIYQEVIDLGGEPITGSQYFGNGRVTEFKYGAKLGTVLRKWNGEKMAYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFQNGADINDWVGPPSNSDGSTKSVPINPDTTCGDGWVCEHRWRQIRNMVIFRNVVDGQ
PFSNWWDNGSNQVAFGRGNRGFIVFNNDDWYMNVDLQTGLPAGTYCDVISGQKEGNSCTG
KQVHVSSDGKANFQISNSDEDPFVAIHVDAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcctcctcctcctcgtggccgtagggctgtgccaggcacagtacaaccccaac
actcagcctgggaggacgtctatcgtgcatctcttcgaatggcgctgggccgatattgct
caggagtgtgaacgctatttagctccgaatgggtttggaggagttcaggtttctcctccg
aatgaaaacattgtcattaccaatccgaacaggccctggtgggaaagataccagcccatc
agctacaagatctgcagtcgatcgggcaatgaaaatgagttcagagacatggtgaccaga
tgcaacaatgttggcgttcgtatttacgtggatgctgttgtcaatcacatgtgcgggtct
atgggcggcacgggcacccactcgacgtgcgggagctatttcaacaccgggagtagagat
tttcctgccgtgccctactcagcctgggattttaatgacggcaaatgtcatactgcaagc
ggagatattgagaactatggggacatgtatcaggttcgtgattgtaagttgtctagcctt
ctcgatctggctctggagaaggactacgtacgctcaacagttgcggcatacatgaatcgt
ctcattgatatgggcgtggcaggcttccggctcgatgccgccaagcatatgtggcctggg
gacatccgagcgtttctggataaattgcacgatttgaatactcagtggttttcagctgga
acaaaaccctttatttaccaagaggtcattgacttgggaggagagccgatcacaggcagt
cagtactttggtaacgggcgagtgacagaattcaagtacggtgctaaactggggacggtg
ttgcgcaagtggaacggagagaagatggcctacttaaagaactggggagaaggctggggc
ttcgtgccttccgatcgagccctggtcttcgtggacaaccacgacaaccagcgcggtcac
ggggcgggaggagcttccattctcactttctgggacgccaggctgtacaagatggcagtc
ggtttcatgctcgctcatccctatgggttcacacgagtgatgtcaagttatcgttggccg
agatatttccagaacggagcggacataaatgactgggttggaccaccgagtaactcggac
ggatcaacaaagtctgttccgatcaacccagatactacatgtggcgacggttgggtctgt
gaacatcgctggagacaaataaggaacatggttatcttccgtaatgtggtagacggtcag
cctttctcaaactggtgggataacgggagcaatcaggtggcttttggccgtggcaacaga
ggcttcattgtgtttaataatgatgactggtacatgaatgttgatttgcaaacggggctg
cctgccggtacctactgtgatgttatttccggacaaaaggaaggcaattcatgtactgga
aagcaggtgcatgtttcttcggatggaaaggctaatttccagattagcaacagcgatgaa
gacccatttgttgcaattcacgttgatgctaagttataa

DBGET integrated database retrieval system