KEGG   Coturnix japonica (Japanese quail): 107317330Help
Entry
107317330         CDS       T04297                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00590  Arachidonic acid metabolism
cjo01100  Metabolic pathways
cjo04370  VEGF signaling pathway
cjo04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107317330 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107317330 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107317330 (PTGS2)
Enzymes [BR:cjo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107317330 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 107317330
NCBI-ProteinID: XP_015725377
LinkDB All DBs
Position
8
AA seq 603 aa AA seqDB search
MLLPCALLAALLAAGHAANPCCSLPCQNRGVCMTTGFDRYECDCTRTGYYGENCTTPEFF
TWLKLTLKPTPNTVHYILTHFKGVWNIINNISFLRDTIMRYVLTSRSHLIDSPPTYNSDY
NYKSWEAYSNLSYYTRSLPPIGHDCPTPMGVKGKKELPDSKLIVEKFLLRRKFIPDPQGT
NVMFAFFAQHFTHQFFKTDHKKGPGFTKAYGHGVDLNHIYGETLERQLKLRLRKDGKLKY
QMINGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRV
AGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFMLKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPGLLVEKPRPGAIFGETMVEIGAPFSLKGLMGNTICSPEYWKPSTFGGKV
GFEIINTASLQKLICNNVKGCPFTAFHVLNPEPTEATINVSTSNTAMEDINPTLLLKERS
AEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcttctaccctgtgcattgctggccgctctcctggctgccggccacgcagccaaccct
tgctgctccctcccgtgtcagaacagaggtgtgtgcatgacaacaggatttgatcggtat
gaatgtgactgcacaaggactggctattatggggaaaactgtacgacaccggaattcttc
acgtggctgaaactaacactgaaacctacgccaaatactgtccactacattctcactcac
ttcaaaggagtctggaacatcatcaacaatatttccttcttacgagatactattatgaga
tacgtgttgacgtcaagatcacacttgattgacagcccaccaacatacaatagtgactat
aattacaaatcctgggaagcttattccaatctttcctattacacaagaagccttccacca
ataggacatgactgtccaacaccgatgggtgttaaaggtaagaaagagctcccagattca
aagctgattgtggagaaattcttgctgcgaagaaaatttattcctgacccacaaggcaca
aacgtgatgttcgctttctttgcccagcatttcacccaccagttcttcaagacagaccat
aagaaaggacctggcttcactaaagcttatggccatggggttgacttgaaccacatttat
ggagagaccctggagagacaacttaagttaagacttcgcaaggatggaaaactaaagtac
cagatgattaatggagaaatgtatccaccaactgtaaaggacactcaagcagagatgatc
taccctcctcatgttcctgagcacctacagttttctgttgggcaggaggtgtttggcttg
gtcccaggcttaatgatgtatgcaacaatatggctgagagaacacaatagagtctgtgac
atcttgaaacaggagcatccagagtgggatgatgagcagctatttcagactacaagactc
atattgataggagaaacgatcaagatagttattgaagattacgtgcagcacttgagtggc
taccacttcaaactgaagtttgatcctgagcttctgttcaaccagcgttttcaataccag
aaccgaattgcagctgaattcaatactctgtaccactggcacccacttctgcctgacact
tttcagatccatgaccaggagtacactttccagcagttcctctacaacaactccataatg
ctggaacatggtctttcccatatggtgaaatctttctccaagcaaagtgctggcagggtt
gctggtgggaaaaatgttccagctgcagtacagaaagtagcaaaggcttcaattgaccaa
agtagacaaatgagataccagtccttgaatgagtacaggaaacgcttcatgttgaaacca
ttcaaatcatttgaggaacttacaggagaaaaagaaatggctgctgaactagaagaactt
tatggagacatagatgctatggaactgtatcccggccttcttgtagaaaagccacgacca
ggtgccatctttggtgaaacaatggtagaaattggtgcaccgttctctctgaaaggactg
atgggaaatacaatatgctcccctgagtactggaagccaagcacctttggtggaaaagtg
gggtttgaaataatcaatactgcctccttacagaagctcatctgcaacaatgtgaaaggc
tgtcctttcactgctttccatgtcttaaatcctgaacccacggaggcaaccattaatgtt
agtacctcaaacacagcaatggaagatatcaaccccacactgctactgaaagagcgatct
gctgagttgtaa

DBGET integrated database retrieval system