KEGG   Coturnix japonica (Japanese quail): 107317865
Entry
107317865         CDS       T04297                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04012  ErbB signaling pathway
cjo04068  FoxO signaling pathway
cjo04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107317865 (CDKN1B)
   04068 FoxO signaling pathway
    107317865 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107317865 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107317865
NCBI-ProteinID: XP_015726506
LinkDB
Position
1
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPINHEELNRDLKKHRKEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDLSFRPLRLPKAICKSIVCQSLDENKNCQTAICAS
SQGISEDTHCAGGKTSVAGGQTDFAEQCAGQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccctggagcgcatggaggcgcgacag
tcggagtacccgaagccgtcggcctgcaggaacctcttcgggccgataaaccacgaagag
ttaaacagggacttgaagaagcaccgcaaggaaatggaagaggcatgccagaggaagtgg
aatttcgatttccagaaccacaagccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttgtccttcagaccactgaggctacccaaagccatatgcaag
tccatcgtctgtcagagcctggatgaaaacaagaattgccaaacagcaatttgcgcctct
tctcagggaatctcagaggatacccactgtgcaggcgggaagaccagtgttgctggcggt
cagacggactttgcagagcagtgcgccgggcagaggaaaagacccgccgccgacgattcc
tctcctcaaaataaaagagccaacacaacagaagaggaggtttcagaagactcccccagt
gccagttcagtggagcaaacgcccaagaaatcgagcccgagacgacatcaaacgtaa

DBGET integrated database retrieval system