KEGG   Coturnix japonica (Japanese quail): 107317929Help
Entry
107317929         CDS       T04297                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00511  Other glycan degradation
cjo00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    107317929 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107317929 (NEU2)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     107317929 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR
Motif
Other DBs
NCBI-GeneID: 107317929
NCBI-ProteinID: XP_015726638
LinkDB All DBs
Position
9
AA seq 406 aa AA seqDB search
MKLKAAGMMFWCMSGTLSRKSKEQGGTMALFPVLKQEVLFRNGTWSYRIPALLYLPRFSI
ILAFAEEREDLVDEHAKLIVMRRGTYNPATHHVQWSSMETIVNAKLEGHRSMNPCPVYDE
VSGNLILFFIAVPGKISEHHQLRTKINLVRLCYVTSVDQGHTWSPAQDITESTISTEYKN
WATFAVGPGHGLQLSNEPRSLVIPAYAFRIIDHKQHPVSYSFCFISSDHGMTWEMGNFVG
KESAGECQVAEIHRCGMNVLYCNARTNRGARVQAVSYNNGVDFDEGHRVEKLVEPPSGCH
GSIVAFPPPPYVWCQDSWLLYAHPADPKGRRDLGIYLNRSPLNPAHWTKPSILFKGLCAY
SDLQYMGIGPDGSPLFSCLFEYGIHRQCEEMIFVMFTLKQAFPSEF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaagcagcaggaatgatgttttggtgcatgtcaggcacactgagcaggaag
agcaaagagcaaggaggcacaatggctttgtttcctgtcctcaagcaagaggtgttgttc
cggaatggcacgtggagctatcgaattccagcactgctctacctgccgcgtttcagcatc
atcctggcatttgctgaggaacgagaggatttggtggatgagcatgctaagctcatagtg
atgcgcagaggcacgtacaacccagccacgcaccatgttcagtggagcagcatggagacc
attgtcaatgcaaagctggaaggtcaccgatccatgaatccctgtcctgtttatgatgag
gtctcggggaatctgatcctgttcttcatagctgtcccaggaaagatctctgagcaccac
cagctcaggacaaagatcaacctggtacgtctctgctacgtcactagcgtggaccaagga
cacacgtggagccctgcgcaggatatcactgagagtaccatcagcacagagtacaagaac
tgggcaacttttgcagtgggacctggtcatggattacagctgtccaatgagccccggagc
cttgtgattcctgcctacgcctttcgtatcattgaccataagcaacaccctgtctcttat
tccttctgcttcatcagctctgaccatgggatgacgtgggagatggggaactttgtggga
aaagagagtgcaggggagtgccaggtagctgagatacaccgctgtggcatgaatgtgctc
tactgcaacgcgaggaccaacaggggagcgagagtccaggctgtcagctacaacaacggg
gtggattttgatgaaggccatcgggttgaaaagcttgtagagcctccctctggatgtcat
ggaagtattgttgccttccctcctcccccttacgtctggtgccaagatagctggctgctt
tacgctcatcctgcagacccaaagggacgaagagatttaggaatttacctcaacagaagc
cctttaaatccagcacattggacgaagccaagcatcctcttcaagggcttatgtgcttac
tcagatctgcagtacatggggattgggccagatggctcacccttgttctcctgtctcttt
gaatatgggatccatcgacagtgtgaagagatgatctttgtaatgttcactttgaagcaa
gccttcccatctgagttctga

DBGET integrated database retrieval system