KEGG   Coturnix japonica (Japanese quail): 107319225Help
Entry
107319225         CDS       T04297                                 

Definition
(RefSeq) trypsin I-P1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04080  Neuroactive ligand-receptor interaction
cjo05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107319225
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    107319225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjo01002]
    107319225
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjo04147]
    107319225
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107319225
Peptidases [BR:cjo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107319225
Exosome [BR:cjo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107319225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 107319225
NCBI-ProteinID: XP_015729392
LinkDB All DBs
Position
1
AA seq 248 aa AA seqDB search
MKYLLLLAFVGVAVALPISDGDDDKIVGGYSCAKNAVPYQVSLNSGYHFCGGSLISSQWV
LSAAHCYKSSIQVKLGEYNLASQDGSEQTISSAKIIRHPGYNSDTLNNDIMLIKLSRPAT
LNSYVNTVPLPSSCVTTGTSCLISGWGNTLSSGSEYPDILQCLNAPVLSSSQCSSAYPGQ
ITSNMICIGYLNGGKDSCQKDSGGPVVCNGQLQGIVSWGYGCAQKGYPGVYTKVCNYVSW
IQSTMSSN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacttactgcttctcgccttcgtgggtgtggctgttgccctccccatcagcgat
ggggatgatgacaagattgtgggaggctacagctgtgcaaagaacgctgtaccctaccag
gtgtctctgaattctgggtatcacttctgcggaggttctctcatcagcagccaatgggtg
ctgtcagctgctcactgctacaagtcttccatccaagtgaagcttggtgaatacaacctg
gcatcccaagacggcagtgagcagaccattagctcagctaaaatcatccgccatcctggc
tacaattccgacacgctcaacaacgatatcatgctcatcaaactatccagaccagccaca
ctcaactcctatgtcaacacagttcctctgcctagcagctgtgtgaccactggaacatcg
tgcctgatctccggatggggcaacacactcagcagtggcagtgaatacccagatatcttg
cagtgcctgaatgcccctgtactctcctcaagccagtgcagcagcgcttaccctggtcaa
attaccagtaacatgatctgcataggatacctgaatggaggaaaggactcctgccagaag
gattccggtggtccagtagtctgcaacggacagcttcagggtattgtttcctggggctat
ggatgtgcacaaaaaggttatcctggtgtttacactaaggtttgcaattatgtttcctgg
attcaatcaactatgtcttccaactga

DBGET integrated database retrieval system