KEGG   Coturnix japonica (Japanese quail): 107319560
Entry
107319560         CDS       T04297                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
cjo  Coturnix japonica (Japanese quail)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 PHD C1_2 Ras_bdg_2
Other DBs
NCBI-GeneID: 107319560
NCBI-ProteinID: XP_015729963
LinkDB
Position
12
AA seq 340 aa
MELIELRELQPEPRPGRGRLERTNALRISPARRHGPGARPEHRPAAPSTGHRFEPRRRGL
HTWCDLCGDFVWGGGRKSLQCRHCSFTCHYRCRALVRLDCSGPPGTGDEDDGSEQELEKD
TNVDEPSSWETAELDPAQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLARPVSV
PAAKRGPGGRPGQRPAGVKRRTSFYLPRGTVKHLHVLSHTRASDVISALLRKFTVVDDPR
KFALFERSEKDEQVYLRKLADDERPLRLRLLAGPDTNVLSFVLKENETGEVNWDAFSLPE
LHNFLLILQREEAEHMRRVRHRYARCRRELQAALAARTTG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagctgatcgagctgcgggagctgcagccggagccgcggccgggccggggccgcctg
gagcgaaccaacgcgctgcgcatcagcccggcccgtcggcacggccccggagcgcggccc
gaacacagaccggcggcaccgagcaccgggcatcgcttcgagccccggcgccgcgggctc
cacacctggtgcgacctctgcggggatttcgtctggggaggcggcaggaagagcctccag
tgccgccactgcagcttcacctgccactaccgctgccgggccctggtgcggctggactgc
agcggccccccaggcaccggggacgaggacgatggcagcgagcaggagctggagaaggac
acgaatgtggatgagcccagcagctgggagacggcggagctggacccggcgcaggtggag
cagcgcatcaaggagtacaacagccagatcaacagcaacctcttcatgagcctgaacaag
gacggctcctacaccggcttcatcaaggtgcagctcaagctggctcgccccgtctcggtg
ccggccgccaagcggggtccgggggggcggccggggcagcgcccggcgggtgtgaagcgg
cgcacgtcgttctacctgccccggggcaccgtcaaacacctgcacgtgctgtcacacacc
cgcgccagcgacgtgatcagcgcgctgctccgcaagttcaccgtggtggacgatccccgc
aagttcgcgctgttcgagcgctccgagaaggatgaacaagtgtacctgcgcaaactggcg
gacgacgagcggccgctgcggctgcggctgctggccggccccgacaccaacgtgctcagc
tttgtgctgaaggagaatgagactggggaagtgaactgggacgcgttctcgctgccggag
ctgcacaacttcctgctcatcctgcagcgggaggaggccgagcacatgcgccgtgtccgc
catcgctacgcccggtgccgccgggagctgcaggccgcgctggccgcccgcacaacgggc
tga

DBGET integrated database retrieval system