KEGG   Coturnix japonica (Japanese quail): 107320055
Entry
107320055         CDS       T04297                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107320055 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107320055 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjo04052]
    107320055 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:cjo00536]
    107320055 (FGF1)
Cytokines and growth factors [BR:cjo04052]
 Growth factors
  Growth factors (RTK binding)
   107320055 (FGF1)
Glycosaminoglycan binding proteins [BR:cjo00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107320055 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107320055
NCBI-ProteinID: XP_015731001
LinkDB
Position
13
AA seq 155 aa
MAEGEITTFTALTERFGLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAEDVGEVYIKSTVSGQYLAMDTNGLLYGSQLPGEECLFLERLEENHYNTYISKKHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggagataaccaccttcactgccctgaccgagcgctttggcctgccgctg
ggcaactacaagaagcccaaactcctgtactgcagcaacgggggccacttcctacggatc
ctgccggacggcaaagtggacggaacacgggaccggagtgaccagcacattcagctccag
ctcagtgcggaagacgtgggtgaggtctatataaagagcacagtgtcagggcagtacctg
gcaatggacaccaatgggctcctgtatggctcgcagctaccgggcgaggagtgcctgttc
cttgagaggctcgaggagaaccattacaacacatacatctccaaaaagcacgcagacaag
aactggtttgttgggctgaagaagaatgggaacagcaagctggggccgcggactcactat
gggcagaaggcgatcctcttcctcccattgccagtgtcagctgactga

DBGET integrated database retrieval system