KEGG   Coturnix japonica (Japanese quail): 107320667Help
Entry
107320667         CDS       T04297                                 

Gene name
GAAI
Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00052  Galactose metabolism
cjo00500  Starch and sucrose metabolism
cjo01100  Metabolic pathways
cjo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107320667 (GAAI)
   00500 Starch and sucrose metabolism
    107320667 (GAAI)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107320667 (GAAI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjo04147]
    107320667 (GAAI)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107320667 (GAAI)
Exosome [BR:cjo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107320667 (GAAI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 RL11D
Motif
Other DBs
NCBI-GeneID: 107320667
NCBI-ProteinID: XP_015732253
LinkDB All DBs
Position
14
AA seq 985 aa AA seqDB search
MGDVTRPRPHNLPPARPEVPRPPPELWAAGVASVLPRETPTTARPSCSASPRTMRSYQKL
RTAVPQLVLSQEEEEEEEDATTPTPAGRSKLAPWWVGSGLLITAVLLSTITVWVLRQVSR
GWHGPAPPAQCHLVPESHRYDCYPERNVVVTQELCESRGCCFIQTLPAVGGKQGVPWCFY
PPDFPSYVVQSLNQTALGMTGLLVRREKAYYPKDIQMLRMDVEFQTNTRLHIKITDAANP
RYEVPLEVPRVTKRAENPIYSLEISQDPFGVLLRRQGTGTVLLNTTVAPLIFADQFLQIS
TTLPSRFLYGLGEHRSNLLHSLDWNTLTLWARDVAPTESFNLYGAHPFYLLMEEGGDAHG
VFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQEVIGFPAMPPLWAL
GFHLCRWGYGSSNETWQTAKAMRNFQIPQDAQWNDIDYMDGYRDFTFDPQKFASLPSLVE
DLHKHGQHYVIILDPGISSTSPRGSYWPFDEGLRRGLFLNTTQGQTLIGQVWPGYTAYPD
FSNTDTHQWWLENLQRFHTHVPFDGLWIDMNEPSNFMDGSEEGCPPGELDSPPYTPAVLG
NSLTAKTVCASAEQNASVHYNLHNLYGLKEAEATASALIQIRGKRPFVISRSTFPSQGRY
SGHWLGDNRSQWKDMYYSIPGMLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFYP
FSRNHNNQNEKAQDPTAFSPSARTAMKDALLTRYSLLPFLYTLFHRAHLQGETVARPLFF
EFPWDVATYGLDRQFLWGQSLLVTPVLEPGADSVLGYFPQGVWYDFYTGSSVNSSGEMLK
LSAPLDHLNLHLREGSILPTQKPGITSKATRGNPLRLIVALSTRATAWGDLFWDDGESLD
TFEQGNYSYLVFNATENIFTSNVLHASTEATDVTIDAVSFYGVQEPPSKVLLDGQEKPFS
YLDNQVLTVSGLGLVLSQGFSLQWL
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgtcaccaggccacgcccacacaacctcccgccggcgcgccccgaagtcccg
cgcccgccacctgagctctgggcagcgggtgttgcatcagtgctgccaagggaaacaccc
accacggcccgaccctcctgcagtgccagccccaggacaatgaggtcgtaccagaagctg
aggacggcggtgccacagctggtattgagccaggaggaggaggaggaggaggaggatgcg
accaccccgacacctgctggccgcagcaagctggccccgtggtgggtgggcagcgggctg
ctgatcactgccgtgctgctgagcaccatcaccgtctgggtgctgcgacaagtgtccagg
ggctggcacggccccgcaccgcctgcacagtgccacctggtccccgagagccaccgctat
gactgctaccccgagaggaacgtggtggtgacccaggagctgtgcgagagccggggctgc
tgcttcatccagaccctccctgcagtggggggcaagcagggggtgccctggtgcttctac
ccacccgacttccccagctacgtggtgcagagcctcaaccagacagcgctgggcatgacg
gggctgctggtgcgcagggaaaaagcctattaccccaaggacatccagatgctgaggatg
gatgtggagttccagacaaacacccggctgcacatcaagataaccgatgcagccaatccc
cgctatgaggtgcccctggaagttccccgagtgacaaagagagcagaaaaccccatctac
agcctggagatctcccaggatccctttggggtgctgctgaggcgccaagggacagggaca
gtgctgctcaacaccaccgtggctcccctgatcttcgccgatcagttcctgcagatctcc
accacgctgccctccaggttcctgtatgggctgggggagcaccgcagcaacctgctgcac
agcctcgactggaacacactcaccctctgggcccgtgatgtggcccccacggagtccttc
aacctgtacggcgctcaccccttctacctgctgatggaggagggcggcgatgcccacggg
gttttcctcctcaacagcaatgccatggaggtggccctgcagcctgccccgggcctgacc
tggagaaccattggaggtgtgctggacttctacatcttcctggggcctgaccccaacatg
gtcatccagcagtaccaggaggtgataggtttcccagccatgccgcccctctgggcactt
ggcttccacctctgccgttggggttacggctccagcaatgagacctggcagactgcaaag
gccatgaggaacttccagatcccacaggatgcgcaatggaacgacatcgattacatggac
gggtaccgggacttcacctttgatccccagaaattcgcctccctcccttcactggtggaa
gatctccacaagcacgggcagcactacgtgataatcttggaccccggcatcagcagcacc
agcccacgtggctcctactggcctttcgatgaaggcttgagacggggtttgttcctaaac
accacccaggggcagacgctgatcgggcaggtctggcctggttacactgcctaccccgac
ttctccaacacagacacacatcagtggtggctggagaacctgcagcgcttccacacccac
gtacccttcgatggcctctggatcgacatgaatgagccatccaacttcatggatgggtct
gaagagggctgcccacctggagagctcgacagccccccgtacacgccggctgtgctgggc
aattccctgaccgccaagacggtgtgtgcctcagcggagcagaacgcatcggtgcactac
aacctgcacaacctctacgggctgaaagaagccgaagcgacggcgagcgccttgatccag
atccgagggaagcgtccctttgtcatctcccgctccaccttccccagccagggtcggtac
tcgggtcattggctgggtgacaacaggagccaatggaaggacatgtattactccatccca
gggatgctgagcttcagcctgtttgggatcccactggtgggggccgacatctgtggcttc
tccggcagcacctcggaggagctgtgcacccgctggatgcagctcggggccttctacccc
ttctcccgcaaccacaacaaccagaacgagaaggcccaggaccccacagctttcagcccc
tcggccaggacagccatgaaggacgcactgctcacccgctactccctcctgcctttcctc
tacacgcttttccatcgtgcccacctgcaaggggagaccgtcgcccggcctttgttcttt
gagttcccctgggatgtggccacatacgggctggacaggcagttcctgtgggggcagagc
ctgctggtgacaccggtgctggagcccggagcagactcagtgctgggctatttcccccag
ggcgtgtggtacgacttctacacgggctcctctgtgaacagcagtggggagatgttaaag
ctgtcagcccccctggaccacctcaacctgcatctccgggagggttccatcctgcccaca
cagaaacccgggatcaccagcaaggccacccgagggaaccctctgcgtctcattgtggcc
ctgtccacacgtgccactgcctggggggacctcttctgggatgatggagagagcctggac
accttcgagcagggcaactactcctacctggtgttcaatgccacggagaacatcttcacc
tccaacgtccttcatgccagcaccgaggccaccgatgtcaccatcgatgcagtgagtttc
tatggagtgcaggagcctcccagcaaagtcctcctggatgggcaggagaagcccttctcc
tacctggacaaccaggtcctcaccgtcagtggcctcggcctcgtgctcagccagggcttc
tccctgcagtggctgtga

DBGET integrated database retrieval system