KEGG   Coturnix japonica (Japanese quail): 107321089Help
Entry
107321089         CDS       T04297                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00512  Mucin type O-glycan biosynthesis
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107321089 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cjo01003]
    107321089 (GALNT9)
Enzymes [BR:cjo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     107321089 (GALNT9)
Glycosyltransferases [BR:cjo01003]
 O-Glycan biosynthesis
  Mucin-type
   107321089 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 107321089
NCBI-ProteinID: XP_015733146
LinkDB All DBs
Position
15
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSQELVQIVRSADRRVRSRGAKVGSLAD
RESILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQMTYPDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SHLLKEIILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNNKREGLIRARIQGWKAATSP
VVGFFDAHVEFNIGWVEPALTRIKEDRKRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIP
MANPGVDFGDVSERIALRQRLQCRSFKWYLENVYPEMRVYNNTVTYGEVRNSKASGYCLD
QGAEEDDKAILYPCHGMSSQLVRYSSDGVLQLGPLGSTAFLPDSKCLVDDGKGRTPTLKK
CEDVLRPAQRFWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcacggaaaattaaaactttgttgacggtcaatatcttggtcttcgtggga
atcatcctcttctccgtctactgcaggattcaggatcgttcacaggagctggtgcagatt
gtccggagtgctgatcgacgtgtcaggagtcgaggagccaaggtgggcagcttggctgat
agggagtccatcctgcagcgcctggaccacctggaggaagtggtctacaaccagctaaat
ggccttgcaaagcctatgggattagttgaaggtccaggaggcttgggccaggggggaatg
gctgctaccctaagagatgatagccatgaatcagagactaaatatgaagaatatggttac
aatgcccaactcagtgacaggatatctctcgacaggtccatccctgactacagaccaaaa
aagtgcaagcagatgacctacccagatgacctgccccagatctcggtggtctttatattt
gttaacgaggcactgtctgtcatcctgcgctccgtgcacagtgttgtgaatcacaccccc
tcgcatttgctcaaggagatcattctggtggatgacaacagcgacaatgttgagctcaaa
tttaacctggaccaatatgtcaataaaagatacccaggtctggtgaaaatagtgcgcaat
aacaaacgagaaggactgattcgagccagaatccaaggctggaaagctgcaacctctcct
gttgttgggttctttgatgctcacgtggaattcaacattggctgggtggaacctgcactt
acccggatcaaagaagacagaaagcgaatcatcttaccagcaattgacaacatcaagtac
aacacttttgaagtgcagcaatacgccaatgcagcccatggctacaactggggcctctgg
tgcatgtacatcatcccaccacaggactggcttgataaaggggacgagtcagcacccatc
aggacaccagccatgattggatgctcatttgtagtagaccgagagtattttggtgagatt
ggcttgcttgaccctggcatggaggtctatggaggagaaaacattgaattaggcatgagg
gtctggcaatgtggaggaagtatggaggtgcttccctgctctcgtgtggcacacattgaa
cgcacaaagaaaccctacaacaacgacattgattactatgcaaagcgcaatgccctacgg
gccgcagaggtctggatggatgacttcaagtcccatgtttacatggcatggaacatcccc
atggcaaaccctggagttgattttggagatgtttctgaaagaatagctctacggcagaga
ctgcagtgccggagctttaagtggtacttggagaacgtctatcctgaaatgagagtctat
aataacacggtcacttatggagaggtgcgtaacagcaaagctagtggctactgcttagat
cagggagctgaagaggatgacaaagcaattctttatccatgccatgggatgtcctctcag
ctcgttcgctacagctctgatggtgtcctgcagctggggccgctgggctccaccgccttc
ctacctgactccaaatgcctcgttgatgatgggaagggcaggactccgactctgaagaag
tgtgaggatgtcctgagaccagcacagaggttctgggattttacacagaatggtccaatc
atcagcagagacactggccgttgtctagaagtggaaatgtcaaaggatgcaaattttggg
ctcagattagttgtacaaaggtgctcggggcaaaaatggatgattagaaactggataaaa
cacggccgccattga

DBGET integrated database retrieval system