KEGG   Coturnix japonica (Japanese quail): 107321157Help
Entry
107321157         CDS       T04297                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00010  Glycolysis / Gluconeogenesis
cjo00053  Ascorbate and aldarate metabolism
cjo00071  Fatty acid degradation
cjo00280  Valine, leucine and isoleucine degradation
cjo00310  Lysine degradation
cjo00330  Arginine and proline metabolism
cjo00340  Histidine metabolism
cjo00380  Tryptophan metabolism
cjo00410  beta-Alanine metabolism
cjo00561  Glycerolipid metabolism
cjo00620  Pyruvate metabolism
cjo01100  Metabolic pathways
Module
cjo_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107321157 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    107321157 (ALDH2)
   00620 Pyruvate metabolism
    107321157 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107321157 (ALDH2)
   00561 Glycerolipid metabolism
    107321157 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107321157 (ALDH2)
   00310 Lysine degradation
    107321157 (ALDH2)
   00330 Arginine and proline metabolism
    107321157 (ALDH2)
   00340 Histidine metabolism
    107321157 (ALDH2)
   00380 Tryptophan metabolism
    107321157 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107321157 (ALDH2)
Enzymes [BR:cjo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107321157 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF4815 DtxR
Motif
Other DBs
NCBI-GeneID: 107321157
NCBI-ProteinID: XP_015733271
LinkDB All DBs
Position
15
AA seq 580 aa AA seqDB search
MELIRAEFRKAERRRWAEPEPATRAGAEEGGRVGAERDRAAPGAGGAAQRGGSEQGARRS
AAMLRVAGFASRLCRGPARLLSAAASPIPAPNPSPEIAYNKIFINNEWHDAISKKTFPTI
NPATGEVICQVAEGDKADVDKAVKAARAAFQLGSPWRRMDASHRGKLLHRLADLIERDRA
YLAALETLDNGKPYSISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVANLIKEAGFPPGVVNI
IPGYGPTAGAAISAHMDIDKVAFTGSTEVGHLIKKAAAESNLKRVTLELGGKSPNIIMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKSRVVGNPFDFKTE
QGPQVDEEQFKKILGYINTGKREGAKLLCGGNPAADRGYFVQPTVFGDVQDNMTIAREEI
FGPVMQIMKFKTIEEIIERANNSKYGLAAAVFTKDIDKANYVSQALRAGTVWVNCYNVFG
AQAPFGGYKASGNGRELGEYGLEAYLEVKNVTIKIPQKNS
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagctgatccgagccgagttccgcaaagccgaacgacgcagatgggcagagccggag
ccggcgacacgggccggagccgaggagggggggcgtgtcggggcggagcgggaccgggca
gcgccgggtgcgggcggggcggcacagcggggcggctcggaacagggggctcggcgcagc
gcagcgatgttgcgggtggcggggttcgcctcccggctctgccgcggtccggcccggctg
ctctcggccgccgcttcccccatccccgcacccaacccgagcccggagatcgcctacaac
aagattttcataaacaacgaatggcacgatgcaatcagcaagaaaaccttccccactatc
aatccagctacaggagaagttatctgccaggttgctgagggcgataaggcagatgtggac
aaggctgttaaggcagccagggcagctttccagctgggctcaccttggaggaggatggat
gcttcgcaccgggggaagctgctgcatcgtcttgctgacctgattgagagggaccgggcg
tatctggcggcacttgaaactctggataatggcaaaccttactctatttcctacttggta
gatctggacatggttgtcaaatgcctcagatacttcgcaggctggtctgataaattccac
ggcaaaaccatccctttagatggagacttcttctgttacaccagacatgagccagtggga
gtttgcggacagataatcccctggaacttcccgctgttgatgcaagcatggaaacttggg
cctgccctggctactgggaacgtggttgtgatgaaagtggcggagcagacccccctgagt
gctctctatgtagctaatctgatcaaagaggctggattcccaccaggcgttgtgaacatc
atccctggctatgggcccactgcaggagctgctatctctgcccacatggatatagataaa
gtggccttcactggctccacagaggttgggcacctgatcaagaaagctgcagcagagagt
aatctaaaaagggtgacactggagctcggaggaaagagtccgaatataatcatgtctgat
gctgacatggactgggctgtggatcaggcccattttgccctcttcttcaaccaagggcag
tgctgctgtgcaggatcccgaacatacgtccaagaggatatatacaatgagttcgtggag
aggagtgttgagaaggccaagtccagagtggttggaaacccatttgactttaaaactgag
cagggacctcaggtggatgaagagcagtttaagaagatccttggttacatcaatactggg
aagcgtgaaggagccaaactgctgtgtggtggcaaccctgctgcagatcgtggctatttc
gtccagccaaccgtctttggtgacgtgcaggacaacatgacgattgccagagaggagata
tttgggcctgtcatgcagattatgaagttcaagacaatagaggaaataatcgagagagca
aataactccaagtacggtctagcagcagcagtctttacaaaagatattgacaaggcaaac
tacgtgtctcaggccctgcgagctggaacagtctgggtaaactgctataatgtgtttggt
gcacaagctccatttggtggctacaaagcatctgggaatgggagagagctgggagaatat
ggtctggaggcatatctggaggtgaaaaacgtgacaatcaaaatcccacagaagaactcg
tga

DBGET integrated database retrieval system