KEGG   Coturnix japonica (Japanese quail): 107321404Help
Entry
107321404         CDS       T04297                                 

Gene name
SLC7A4
Definition
(RefSeq) solute carrier family 7 member 4
  KO
K13866  solute carrier family 7 (cationic amino acid transporter), member 4
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjo02000]
    107321404 (SLC7A4)
Transporters [BR:cjo02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   107321404 (SLC7A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-GeneID: 107321404
NCBI-ProteinID: XP_015733768
LinkDB All DBs
Position
15
AA seq 653 aa AA seqDB search
MARWLPRSTDLTRFCQKLNRVKTLEADMMETSFNRCLSTIDLTLLGIGGMVGSGLYVLTG
TVAKEIAGPAVIVSFIIAGFASLLAALCYAEFGARVPKTGSAYMFTYVSVGEIWAFLIGW
NVLLEYMIGGAAVARAWSGYLDSIFNHKIKNFTETHVGSWQVPFLAHYPDFLAAAILLVA
TAFISFGAKVSSWLNHVFSAISMGVILFILIMGFVLAQPKNWSAQEGGFAPYGLSGIMAG
TATCFYAFVGFDVIAASSEEARNPQKAVPRAIAFSLGLATGAYILVSMVLTLMVPWHTLD
PDSALADAFYRRGYSWAGFLVAAGSICAMNTVLLSNLFSLPRIVYAMAEDGLFFQVFSRV
HPRTQVPVIGIVVFGLLMALLALVFDLEALVQFLSIGTLLAYTFVAASIIVLRFQQQKAD
GPAQPASSQPNPEQREGIAAPEQKEYESFSDKLQLVGSDKSKEHREPGQLKAAFEPYLEF
LSDFYPGEVVTVAVVTLMVSAVCLCSILVFGNTHLHLPTWSYSLLLVLFSLGFVLSLLLI
WVHEQQHSTQTFQIPLVPLSPALSIVLNIYLMLKLSYMTWLRFAIWLILGLLVYFGYGIW
HSKENLREPRPQSVSARYVVFPSSSLEETVQAVQPSSQPAAGLPDTDTTEDKR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcgagatggctgccccgttccacggacctgacccgcttctgccagaaactcaacaga
gtgaagaccttggaggccgacatgatggagacgtccttcaacaggtgcctttccaccatc
gatttgacactgctgggaatcgggggcatggtgggctctgggctttatgtcctcacaggc
accgtggccaaggagatcgccggccccgctgtcatcgtctccttcatcattgctggcttc
gcctccctcctggctgctctctgctatgctgagtttggggcccgagtgcccaagacgggc
tctgcctacatgttcacctacgtgtctgtgggtgagatttgggcttttctcattggctgg
aacgtgttgttggagtacatgatcgggggcgcagcggtggccagggcctggagtggttac
ctggactccatcttcaaccacaaaattaagaacttcaccgagacccacgttggctcctgg
caggtgcccttcctggctcactaccctgactttctggcagctgccatcttgttggtggcc
accgccttcatctcctttggggccaaagtatcctcctggctcaaccacgtcttctcagcc
atcagcatgggtgtcatcctcttcattctcatcatgggcttcgttctcgcgcagcccaag
aactggagtgcccaggagggaggctttgccccctatgggctgtcaggcatcatggccggc
acggccacctgcttctacgcctttgtgggcttcgatgtcatcgcagcctccagtgaagaa
gccaggaacccacagaaggccgttcccagggccatcgcattctccttagggttggccact
ggtgcctacatccttgtgtccatggtgctgacgctgatggtgccctggcacacactggat
cctgactctgccctggctgacgccttctacaggaggggctattcctgggcaggattcctg
gtggctgctggctccatctgtgcgatgaacacggtcctgctgagcaacctcttctctctg
ccacgcatcgtctatgccatggccgaggatgggctcttcttccaggtgttctcccgggtg
cacccacgcacacaggtgcccgtcatcggcatcgtggtctttgggctgctcatggccctg
ttggcccttgtcttcgatctggaggctctggtgcagttcctgtccatcggcacattgctg
gcctacacctttgtggctgccagcatcatcgtgctgcgcttccagcagcagaaggcggat
ggcccggcacagccagccagcagccagcccaaccctgaacagcgtgagggcatcgctgcc
cccgagcagaaggagtacgagtccttctccgataagctgcagctggtggggagtgacaag
agcaaggagcaccgtgagccagggcagctgaaggcggcctttgagccctacctggagttt
ctcagtgacttctacccaggtgaggtggtcacggtggctgtggtgaccctgatggtgtct
gctgtctgcctctgctccatcttggtgtttggcaacacccacctccacctgcccacctgg
agctactccctgctgctggtcctcttcagcctgggcttcgtgctcagcctcctcctcatc
tgggtgcacgagcagcagcacagcacccagaccttccagatccccctggttcccctgtct
ccagcgctgagcattgtcctcaacatctatctcatgctgaagctcagctacatgacatgg
ctccgctttgccatttggctcatccttggcctgctcgtctactttggctacggcatctgg
cacagcaaggagaacctgcgggagccacgaccacagagtgtcagcgcccgctatgtggtg
ttccccagcagcagcctggaggagacagtgcaggcagtgcagcccagctctcagcctgct
gctgggctgccggacaccgacaccactgaggacaagagatga

DBGET integrated database retrieval system