KEGG   Coturnix japonica (Japanese quail): 107322733
Entry
107322733         CDS       T04297                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00220  Arginine biosynthesis
cjo00330  Arginine and proline metabolism
cjo01100  Metabolic pathways
cjo04020  Calcium signaling pathway
cjo04146  Peroxisome
cjo04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107322733 (NOS2)
   00330 Arginine and proline metabolism
    107322733 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107322733 (NOS2)
   04020 Calcium signaling pathway
    107322733 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107322733 (NOS2)
Enzymes [BR:cjo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107322733 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400 NAD_binding_6
Other DBs
NCBI-GeneID: 107322733
NCBI-ProteinID: XP_015736546
LinkDB
Position
19
AA seq 1136 aa
MLCPWQFAFKPRVIKNQPSEEKDINNNVEKDTKVHGFVKDDAKLHNLSKKQIPMSPIITA
AEKPPQNGIKASSQISRCPRHVKVRNLENGSSLLDTLHLTAKEVINCRTKACQGALMTPK
GLVRGTRDGPVPPAELLPQAIDFVKQYYSSFKELKIEEHLARLETVTKEIETTGTYHLTK
DELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEYICRHIQYATNNGNIRSA
ITIFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSVIGDPASVEFTKLCIELGWKPKYGRFD
VVPLILQANGQDPEIFEYPPEIILEVPMEHPKYEWFKELDLKWYALPAVANMLLEVGGLE
FTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLASLWKDRAVVEINVAVL
HSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPMSGSITPVFHQEMLNY
VLTPFFYYQVDAWKTHIWQDETRRPKKREIKLSILAKAVLFASLLLRKTMAARSKVTVIY
ATETGKSETLANNLCSLFSCAFDTKILCMDEYNISDLEKETLLLVVTSTFGNGDSPNNGK
TLKNSLLTLKLLRKKIRYAVFGLGSTMYPEFCAFAHAIDRKLSQMGALQLVPVGEGDELN
GQEEAFHAWAVTAFKTACDIFDIRGKNSIRLPEMYSSDDSWNPKKHRIVHGSQTMDLTKA
LADIHAKDIIPMKLKFRQNLQSFKSSRVTILVKLSCETNQEVRYLPGEHIGIFPGNQPEL
VHGLIARVKDAPPADQIIRLETCTEGGYWTSEKKIPACTLSQALTYLLDITTPPSQQLLK
KLSQLVTAEADKQRLEVLCHSTEEYNKWKFYNSLNILEVLEEFPSAEVSTAFLLTQLPLL
KPRYYSVSSSCDMTPGEIHLTVAVVNYRTRDGQGPLHHGVCSTWLNKIALNETVPCFVRS
ADGFRLPEEPAKPCILIGPGTGIAPFRSFWQQRLYDLEKKGIKGGDMILLFGCRQPDMDH
IYKEEVEEMKRKGVLKEVFTAYSRQPGQPKVYVQDILQNELETKVCNILHKEEGHLFVCG
DVRMARDVAQTLKRILVKNLNHTEQQAEEYCFQLKSQKRYHEDIFGAAFPHEVKRI
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgcattcaaacctcgtgttattaagaaccagccctctgaa
gagaaggatatcaataataacgtggagaaagatacaaaggtccacggctttgtgaaagat
gatgccaaattacacaatctaagcaagaagcagataccgatgtcacctataatcactgca
gcagagaagcccccacaaaatggtatcaaagcttcaagccagatatcaagatgtcctaga
catgtaaaagtaaggaacttggaaaatggatccagccttcttgacacattacacctgaca
gcaaaggaggttatcaattgtcggaccaaagcttgccaaggagcactcatgaccccaaag
ggcctggtgagaggcactagagatgggccagttcctccagcagagcttctacctcaggca
atagactttgtcaagcagtactacagttcatttaaagagttaaaaatagaagagcacctg
gcccgactagaaacagtgaccaaagagatagaaacaacaggaacctaccatctgacaaag
gatgaactgatctttgctgctaaacaggcctggaggaatgctccaaggtgtattgggaga
atccagtggtccaatctacaggtatttgatgcacgtgattgtaaaacagccaaggaaatg
tttgaatatatctgtcgccatattcagtatgccacaaacaatggaaatataagatcagcc
atcaccatcttccctcagaggactgatgggaaacatgatttccgtgtttggaacagccag
ctcatccgatatgctggatatcaaatgccagatgggtctgtcataggagaccctgcaagt
gtggagttcacgaagttatgcattgagcttggctggaagccgaaatatggccgctttgat
gtagttcctctcattctccaagcaaacggccaagatccagaaatatttgaatacccgcca
gagattatccttgaagtgccaatggagcatccaaaatatgagtggtttaaggagttggat
ctgaagtggtatgctctgcctgctgttgccaacatgctccttgaggtgggaggcctggaa
tttactgcatgtcctttcaacggctggtacatgggaacagagattggagtgcgggacttc
tgtgatgtacagcggtacaatatcctgaaggaggttggaagaagaatgggactggaaacc
aacaaacttgcatcattgtggaaggaccgagctgttgtagagattaacgttgctgtgctt
catagcttccagaaacaaaatgttactatcatggatcatcactcagctgctgagtccttc
atgaaatacatgcagaatgagtaccgtgtgcgaggaggctgcccagctgattgggtgtgg
attgtacctcctatgtcagggagcataactcctgtgttccaccaggagatgctgaactat
gtcctcactcccttcttttactaccaggtggatgcatggaaaacacacatttggcaagat
gagacccgtaggccaaagaaaagagaaataaagttgagcattttggccaaggctgtactc
tttgcgtcattacttctgcgaaaaacaatggcagccaggtccaaggtgactgtgatctat
gcaacagagactgggaaatcagaaacattagccaacaatctgtgcagtttgttcagctgt
gccttcgacactaagattctgtgcatggatgagtacaacatcagtgacttggagaaagaa
acactgcttttagtggttactagcacttttggaaatggagattctccaaataatggaaag
acactgaagaactccttgctcaccctgaaattgctgagaaaaaaaattagatacgctgtg
tttggtttgggctccaccatgtatcctgagttctgtgcctttgctcatgccattgaccga
aaactgtcccaaatgggggctttgcagcttgttccagtgggtgaaggagatgaactcaat
ggtcaagaagaagcctttcacgcatgggcagtcactgcattcaagactgcctgtgacatt
tttgacatccgtgggaaaaacagtattcggttacctgagatgtactcatcagatgacagc
tggaatcctaagaaacataggatagtacatggctctcaaaccatggacttgactaaagca
ctggcagacattcatgcaaaggatataattccaatgaagctgaaattcaggcagaatctt
cagagtttcaaatccagtcgtgttaccattctagttaagctttcctgtgagactaatcag
gaagtgcgctacctgcctggagaacatattgggattttcccaggcaaccagccagaatta
gtccatggcctcattgcacgtgttaaggatgcccctccagctgatcagattatcagactt
gaaacctgtactgaaggtggctattggacaagcgagaaaaagattcctgcttgcacactc
tcccaggccttgacatacttacttgatatcaccacaccaccctcccaacaactgctaaaa
aaactctcccagctggtaacagcggaagcagataaacagagactggaagttttatgtcat
agcacagaagaatacaataaatggaagttttacaacagcctaaacatcctggaggtcctg
gaagagtttccttctgctgaagtctcaacagctttcttactgactcagctgccacttctg
aaacctagatactactctgtcagttcctcctgtgacatgacgcccggagagattcatctg
acagttgctgtggtaaactacaggacaagagatggacaagggccattgcaccatggagtc
tgcagcacgtggctgaacaaaatagctctcaatgaaacagtcccgtgctttgtgcgcagt
gctgatggattccgactcccagaggagccagccaagccatgcattcttattggtccagga
acaggaattgctccattcagaagtttctggcagcagcgtctctatgacttggaaaagaaa
gggatcaaaggtggtgacatgatattactgtttggctgccggcagccagatatggatcat
atctacaaagaagaagtagaagaaatgaagaggaaaggagttctgaaagaagtttttaca
gcttactccaggcaacctggtcaacctaaagtctatgttcaagatattcttcaaaatgag
ttggaaaccaaagtgtgtaatatcttgcataaagaggaagggcacctgtttgtctgtgga
gatgtacgcatggccagagatgttgctcagactttgaagaggatacttgtaaaaaacctg
aaccacacagaacagcaggcagaagagtattgcttccagctaaagagccaaaagcgatac
cacgaagatatatttggggctgcgttcccacatgaagtcaaaagaatataa

DBGET integrated database retrieval system