KEGG   Coturnix japonica (Japanese quail): 107322910Help
Entry
107322910         CDS       T04297                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107322910
Enzymes [BR:cjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107322910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 107322910
NCBI-ProteinID: XP_015736940
LinkDB All DBs
Position
20
AA seq 696 aa AA seqDB search
RTSHFFLAATQPSTDWHVKENGREHHTSKFSSKELVVRRGQAFVITFNGIEQPEQTLTFI
AETGPKPSKQAKTLATFGISSTASKESWSAVLQSTSSNSVSVSISSPPNAVIGRYKLSVQ
STSTGSSSPEALGTFVLLFNPWSSGDDVFMPNKAECEEYVLEEFGIIFAGNSYHINSFGW
NYGQFQADILNICLAMLDRSLNYRQDPATDVSHRHDPKYLGRVLSAMVNANDDQGVVRGN
WSGNYEGGKSPSSWTGSGEILQNWKQSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRTVTN
FSSAHDADGNLRVDEFYDASGNHLNEGADSVWNFHVWNESWFSRSDLGPSYSGWQILDAT
PQEESGGIYQCGPASRNAVKEGDVDLDYDCPFVFAEVNADCMYWNYDPATRKKTLLFNKS
TVIGQLISTKAVGRDDRIDITSDYKYEEGSKKERDTFKKARKKLGLEDKFDPTAPTPKEI
EQKPDISGRFKMAGPLEVGKDLDLILVLTNLQSEVKSVNVNMTAWSTMYTRKPVREIWKD
SLSVSLSPEEEKHFPIKISYAEYQQQLTTDNAIEVTALCNVEGGIQVLVQRHIALDNPAI
EIQVLGEAKVNKEVDVEVVFTNPIDIEVKDCVLQVEGSDLLRGILKIEVPPLKAREISSM
KFKLTPFETGSKHLLVNFSCDKFADIKAFKTVKVID
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
cgtacttctcactttttcttagctgcgacgcagccaagtactgactggcacgtgaaagaa
aatgggagagagcaccacacaagtaaattttctagcaaagagttggttgtgaggagaggt
caggcctttgtaatcaccttcaatggaatagaacagcctgagcaaaccttaacattcatc
gcagaaacaggcccaaaaccctccaagcaggccaagaccctagccacgtttggtatctcc
agcacagcaagcaaggagagctggagtgcagttcttcagtccaccagttccaactctgtg
agcgtctccatctccagcccacctaatgctgtcatcggacgttacaagctgagtgttcaa
agtacttcaactggcagctcgtctccagaagcccttggcacttttgttttgctcttcaac
ccttggtcttcaggtgatgatgtgttcatgcctaataaggctgagtgtgaggaatacgtg
ctagaagagtttggtatcatttttgcaggcaacagttatcatatcaacagttttggatgg
aactatggccagtttcaagcagatatcctcaatatttgccttgccatgctggatcgaagc
ttgaactaccgtcaggatcctgccacagatgtatcgcaccgacatgatcccaagtatctg
ggccgtgttctcagtgcaatggttaatgccaatgatgaccaaggggtggtacggggaaac
tggagtggaaattatgagggtgggaaaagtccaagcagctggactggaagtggtgaaatc
ctgcaaaactggaagcaatcaggattcaagcctgttagatacggacagtgttgggttttt
gcagcagtattaaccacagtgcttagatgtctagggattcccactcgcacagttacaaac
ttcagctctgcccatgatgcagatggaaacctgcgtgtggatgagttttacgatgcttct
ggaaatcatttgaatgagggagctgacagtgtctggaatttccacgtctggaatgaaagc
tggttttcccgcagtgacttgggcccttcatacagtggatggcaaattctggatgcaact
ccccaagaagagagtggaggaatttatcagtgtggtcctgcctcaaggaatgccgtcaaa
gaaggagatgtagatctggactacgactgtccgtttgtatttgcagaagtgaatgcagac
tgtatgtactggaattatgatcctgcaactagaaagaaaacattattattcaacaagtca
acagtaatcggccaactcatcagcacaaaggcagttggtagagatgatcgtatagatatc
accagtgattacaaatatgaagaaggctctaaaaaagaaagagatacttttaaaaaagca
cgtaaaaagctgggacttgaggataagtttgatcctacagcaccaacaccaaaggaaatt
gaacaaaagcctgatatctcaggaaggtttaaaatggccggtcctttagaagttggcaaa
gacctcgatttaattctggttcttacaaatttacaatcggaagttaaatctgttaatgta
aatatgactgcttggagcaccatgtacacaagaaaaccagttcgtgagatctggaaggac
tccctttctgtctctctgtctcctgaggaagagaaacattttcccattaagatatcttat
gctgaatatcagcagcagttaactacagataatgcgattgaagtaacagctttatgtaat
gtagaaggtgggattcaagtactggtacaaagacatattgccctggacaaccctgccatt
gagatacaggtacttggtgaggcaaaagtgaataaagaagtggatgtggaagtggtattt
accaatcctattgatatagaagtgaaggactgtgtgctgcaggtagaaggcagtgacctg
ctgagaggaatccttaagatagaagtaccaccactgaaagccagagagatatccagtatg
aaatttaaacttaccccttttgagacgggctccaaacatctgcttgttaatttctcctgt
gataaatttgcagatatcaaggcctttaaaactgtaaaggtgattgactaa

DBGET integrated database retrieval system