KEGG   Coturnix japonica (Japanese quail): 107323469Help
Entry
107323469         CDS       T04297                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00020  Citrate cycle (TCA cycle)
cjo00190  Oxidative phosphorylation
cjo01100  Metabolic pathways
cjo01200  Carbon metabolism
Module
cjo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cjo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107323469 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    107323469 (SDHB)
Enzymes [BR:cjo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107323469 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 107323469
NCBI-ProteinID: XP_015738079
LinkDB All DBs
Position
21
AA seq 281 aa AA seqDB search
MAAAVVGVSLRRGVPARLLRAGPRPICRGAQTAAAATSRIKKFSIYRWDPDKPGDKPRMQ
TYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDP
DLSKITKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQK
LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFS
LYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKAAAA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtggtgggagtctccttgaggcgcggcgtccccgcgcggctcctgagg
gctgggccgcggccgatctgtcgaggagctcagacggcagctgcagctacgtcacgtatc
aagaagttctccatctacagatgggatcccgataagcctggggacaaaccccgtatgcag
acgtatgaagtggatttgaataaatgtgggcctatggtacttgatgctctgattaagatt
aaaaacgagttggactctactctgaccttccgcaggtcatgcagggaaggcatctgtggc
tcctgtgcgatgaatattgctggtggaaacaccctggcctgtactaaaaaaattgaccct
gatctcagcaagatcactaaaatctaccctctcccccacatgtatgtggtgaaggatctt
gttccagacttgagtaacttctacgcacagtacaaatccatcgagccttacctgaagaag
aaggatgagtcgaagcagggcaaggagcagtacctgcaatccatagaagatcgtcagaaa
ctggacggactctacgagtgcatcctctgtgcctgctgcagcaccagctgtcccagttac
tggtggaatggggacaagtacttgggtcctgctgtactcatgcaggcctatcgctggatg
attgactccagagatgactatacagaggaacggctggcacaacttcaagacccgttttct
ctctaccgttgtcacactatcatgaactgcacgaggacttgcccgaagggtctgaacccc
ggcaaagccatcgctgagatcaagaagatgatggcgacgtacaaagagaaggcggccgct
gcgtaa

DBGET integrated database retrieval system