KEGG   Coturnix japonica (Japanese quail): 107323622Help
Entry
107323622         CDS       T04297                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    107323622 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjo01002]
    107323622 (TMPRSS2)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107323622 (TMPRSS2)
Peptidases [BR:cjo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107323622 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Ldl_recept_a SRCR Trypsin_2
Motif
Other DBs
NCBI-GeneID: 107323622
NCBI-ProteinID: XP_015738387
LinkDB All DBs
Position
1
AA seq 486 aa AA seqDB search
MTSTVNPPPYYENHGFHAENYYSARPQVGANPYPQYFSTNVPSVPTYIPRVSTHQSSIPV
APSSSSSRTCSSSIKKVIIIILSILVVIGCAIAAFFIWYFVENRCLGSLIECGSSGVCIS
PSQWCDGVSDCPNGEDENRCVRLYGPNFILEVYSPISQTWYPVCQDDWTDDFGKIACQDM
GYNVDTYYYSQGVAAEATYKSFMKLNTSAGNTDLYKRLQSSDYCASGNVVSLRCIECGLP
TKSTAVMSRIVGGSTAALGQWPWQVSLHVQDTHVCGGSIITREWLVTAAHCVEGQFSDHY
IWTVYAGILNQNEMHSRPGYRVQKIISHPNYDTDSKDNDVALMKLDTPLTFTDNVRPVCL
PNPGMMFHPNQQCWISGWGAEVQGGKTANELNYVMVPLIEQSLCNSVYVYDGIVLPTMVC
AGYLHGGIDSCQGDSGGPLVTNKSSVWWLVGDTSWGTGCASPNRPGVYGNMTVFTDWIYK
NMQANR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacctctactgtaaatccaccaccgtactatgaaaatcatggcttccatgcagaaaac
tactattctgccaggccacaagtaggtgctaacccatatccacagtacttttctacaaat
gttccatcagtgccaacctatatcccaagagtttcaacccatcagtcaagcattccagta
gcaccttcatccagttcatccaggacgtgttcatcaagtataaaaaaagtcataataatt
atattatccattttagtagtcattggttgtgcaattgctgctttcttcatctggtacttt
gttgagaatcgttgtcttggatccttaatagagtgtggatcttcaggagtgtgcatttct
ccctcacagtggtgtgatggagtgtctgactgcccaaatggggaggatgaaaaccgttgt
gttagactttatggaccaaacttcatccttgaagtttattcacccatcagccaaacctgg
taccctgtttgtcaggatgactggactgatgattttggaaagatcgcatgtcaagacatg
ggctacaatgtagatacgtattactatagtcaaggagtagcagctgaagccacctataaa
agctttatgaagctaaacacgagtgcggggaatacagacttgtacaaaaggctgcaaagc
agtgattactgtgcatcaggaaatgtggtttctctgcgctgcatagagtgcggcctgccc
actaaaagcacagccgtcatgagcaggattgtgggtggcagcacggcggcactggggcag
tggccgtggcaggtgagcctccatgtgcaggacacacacgtctgtggaggctccatcatc
acccgtgagtggctggtgacagcagcccactgtgtggagggacaattttctgaccactac
atctggaccgtttatgctgggattctgaaccagaacgagatgcactcaaggcctggatac
agagtgcaaaaaataatttcccatccaaattatgatacagattctaaagacaatgacgtt
gcccttatgaagttagatacaccgctgacttttactgataatgtacggccagtttgtctg
cctaacccaggaatgatgttccaccctaatcagcagtgctggatatctgggtggggagca
gaggtccaaggaggtaaaacagcaaatgagttgaattatgtcatggtacccttaatagaa
caatctctgtgtaattctgtctatgtctatgatggcatagtcttgcctacaatggtctgt
gctggatatttacatggaggaattgattcttgtcagggtgacagcggaggtcctctggta
acaaacaaaagctcggtgtggtggttggttggagataccagctggggaactggctgtgct
agtcccaataggcctggagtttatggaaatatgacggtgtttacagactggatttataaa
aatatgcaggccaacagatga

DBGET integrated database retrieval system