KEGG   Coturnix japonica (Japanese quail): 107323712
Entry
107323712         CDS       T04297                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107323712 (TGFA)
   04012 ErbB signaling pathway
    107323712 (TGFA)
SSDB
Motif
Pfam: TMEM239 DUF1180 DAG1
Other DBs
NCBI-GeneID: 107323712
NCBI-ProteinID: XP_015738543
LinkDB
Position
22
AA seq 254 aa
MEQIGEQGGGKGSFKPSPILPVPPAEGTIRRAQRDSAHRALPSGGARNRAPRGRGPRSSA
PGPSGSPRPFPPARSPAPRPNWALRTASSAATTATATRMTGEAAALALGMLVAVCHALEN
TTSALSDPPVAAAVRSHFNECPDSHRQFCFHGTCRFLVQEDKPACVCHSGYVGTRCEHAD
LLAVVAANQKKQTITALLVVAVVASAVLIAACVLVHCCRLRKRCGCCRVPLCGQEKPSGL
LKGGASCCHTESVV
NT seq 765 nt   +upstreamnt  +downstreamnt
atggagcagataggggagcaaggaggagggaagggcagcttcaaaccttcccccatcctc
cccgtccctccagccgagggaacgatccgccgagcgcagcgggacagcgcgcaccgagcg
ctgccgtcggggggagctcggaaccgggcaccgcggggccgggggcctcgtagctccgcc
ccggggccgtcggggagtccgcgcccatttccgccggctcggagcccggcccctcggccg
aactgggcgctacgaaccgccagctccgccgccaccaccgccaccgccaccaggatgacg
ggagaggcggctgcgctggcgctgggcatgctggtggctgtgtgccatgccctggagaac
acaacgtcagcgctgagcgatcccccagtggcagcggctgtgcggtcacacttcaatgag
tgccccgactcccaccggcagttctgcttccatgggacgtgccgcttcctggtgcaggag
gacaagccggcgtgtgtgtgccactcaggctacgtggggacgcgctgtgagcacgccgac
ctgctggccgtggtggccgccaaccagaagaagcagacgatcaccgcgctgctggtggtg
gccgtggtggcctcagcggtgctcatcgccgcctgcgtgctcgtccactgctgccggctg
cggaagcgctgcgggtgctgccgggtgccgctctgcgggcaggagaagccatcggggctg
ctgaagggaggagcgtcctgctgccatactgagagtgttgtctga

DBGET integrated database retrieval system