KEGG   Coturnix japonica (Japanese quail): 107324577Help
Entry
107324577         CDS       T04297                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107324577 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjo03036]
    107324577 (SETDB1)
Enzymes [BR:cjo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107324577 (SETDB1)
Chromosome and associated proteins [BR:cjo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107324577 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107324577 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 107324577
NCBI-ProteinID: XP_015740190
LinkDB All DBs
Position
25
AA seq 1284 aa AA seqDB search
MSAGTTAEMDSEDIKELQEEVMEEMGISMEELQDIINKELEKCEYVKQKKQQLEELEMYV
KQKEEEVAHVDQLFDDAWRDFDKCEMLVKDLYSKLGLEYRESSSEEEDMVAKPSEVIEIP
DDDDDDDVMSIDSGWKNSDPSPGVAKDQTLLREAMAAMRRSAQDVQKFVDAVHRRTNTQD
TLKDAQTPQQAPAALQPSGPAVGDLSNDGDLKVGMRILGKKRTKTWHKGTLIAIQTVGAG
KKYKVKFDNKGKSLLSGNHIAYDYHPSPDKHYVGSRVVAKYKDGDQVWLYAGIVAETPNV
KNKDRFLIFFDDGYASYVKEWELYPVCRPLKKTWEDIEDVSCRDFIEEYISAYPNRPMVL
LKNGQLIKTEWEGTWWKSRVEEVDSSLVKILFLEDVAVDAVSVAFSLLQDDKRCEWIYRG
STRLEPMFSMKTSTASTQEKKQSGQARTRPNVGAVRSKGPVVQYTQDLTGAGTQYRPLEQ
MQAASLAAQPTSPQHTEMECSDSLLAQSRKQVAKKSTSFRPGSGQLSPSPPVLSDAPPPG
RAAAAQQHRFPSGPAGATQLFHGMMDRVPNEPSYRAPLEKLFYLPHVCSYTCLSRVRPVR
SDQYRSKNPLLIPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRSMAEIERYLFETDC
DFLFLEMFCLDPYVLVDRKFQPYKPYYYIADITKGREDVPLSCVNEIDSTPPPQVAYSKE
RIPGKGVFINTGWEFLVGCDCRDGCRDKSKCACHQLTVQATGCTPGGQINPNSGYQHKRL
EECLPTGVYECNKRCKCNVNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVC
IYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAKCSSDSSGVDLKDDEE
DNTGTEEQEESNEDSSDDNFCKDEGFNTSSVWRSYATRRQTRGQKENGLLETASKDSGLT
PRVGHDEAAAAASCKLPVSEESSKNKVASWLSSNSVADSFQDNNSTSSFKMSEEAKGCRA
EPAPGGAEGEAKALKKDEPEDSRRLPGLSDMGRMYGYNPSPPKLEGVRRPTSKTALLQSR
RHLALLQLRAEDVLTLSSSTDSDGDNGPKVEGQPQSTANDSDDIQTISSGSEEEEGDEKK
NLSGSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMAAAEKGDSAPVCKTTRQFYDGEESC
YIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNY
EVGSVEGKELLCCCGAIECRGRLL
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggggacaacggcagaaatggattccgaggacatcaaagagctgcaagaagaa
gtgatggaggaaatgggaatctccatggaggagctgcaggacatcatcaacaaggagctg
gagaagtgtgagtacgtgaagcagaagaagcagcagcttgaggagctggagatgtatgtg
aaacagaaggaagaagaggtggctcatgttgaccagctctttgatgatgcttggagagac
tttgataaatgtgagatgctggtaaaggatttgtattccaagctgggcttggagtaccgt
gagagcagctctgaggaggaggacatggttgccaaaccctctgaagtgattgagatcccg
gatgatgatgacgacgacgacgtcatgagcatcgattcgggatggaagaacagtgatccc
agtcccggagttgccaaggatcagactctgctgcgggaagccatggcagcaatgagaaga
tctgcccaggatgttcagaagtttgtggatgctgtgcacaggagaacaaacactcaggat
acactgaaagatgcacaaacccctcaacaagctcctgctgctctccagccttctggacct
gctgtgggtgatctgagcaatgatggagatctgaaggttggcatgaggatcctgggcaag
aagagaaccaaaacatggcacaaaggaactctgattgccatccagacggttggtgctggt
aagaaatacaaagtgaagtttgacaataaggggaagagtttgctttctggcaatcacatc
gcttatgactatcacccctccccggacaaacactacgttgggagcagagttgtggcaaaa
tacaaagatggagatcaagtttggctgtatgctggcatagtggctgaaacaccgaacgtg
aagaacaaagacaggttcttgatcttctttgatgatggctatgcttcttatgtcaaggag
tgggagctgtacccagtctgcaggccacttaagaagacgtgggaggacatagaggatgtg
tcgtgccgggacttcattgaggagtacatcagtgcttaccccaaccgccccatggtgctg
ctaaagaatggacagctgatcaaaactgaatgggaagggacctggtggaaatccagggtg
gaagaagtggacagcagtctggtcaaaatcctcttcctggaagatgttgctgtagatgct
gtgagtgttgcattctccttgctgcaggatgacaaacggtgtgagtggatttaccgggga
tccacacgcctcgagcccatgttcagcatgaaaacctccactgcctccacccaggagaag
aagcagagtggacaggcaaggactcggcccaatgtaggtgctgtacggagcaaaggcccc
gtagtccaatatacacaagatctgaccggagctggaacccaatacagacccctggagcag
atgcaggcagcctcactggcagcacagcccacttctcctcagcacactgagatggagtgc
tctgacagtctgctggcccagtcgaggaagcaggtggccaagaagagcacatccttccgt
cccggctcagggcagttgtcgccttcacctcctgtgctgagtgatgcacctccaccagga
agggcagctgcagcccagcagcatcgcttccccagtgggccagcgggcgcaacgcagctc
ttccatggcatgatggaccgcgtgcccaacgagccgtcataccgcgcaccgctggagaag
ctcttctacctgccccacgtctgcagctacacctgcctgtcccgcgtgcggcctgtgcgc
agtgatcagtaccgcagcaagaacccgctgctcatccctctgctctacgacttcaggagg
atgacagcccgtcgcagggtgaaccgtaagatgggcttccacgtcatctataaaacaccg
tgcgggctctgcctgcgtagcatggccgagatcgagcgttacctcttcgagaccgactgt
gacttcctcttcctggagatgttctgtttggatccctacgtcttggtggatcgcaagttc
cagccttacaaaccttactattacattgctgacatcaccaagggccgcgaggacgtgccg
ctgtcctgtgtcaatgagatcgacagcacaccaccgccacaggtggcctatagcaaagag
cgcatccccggcaagggagtcttcatcaacacgggctgggagttcctggtgggctgcgac
tgcagggacggctgcagggacaaatctaagtgtgcctgtcaccagctgacagtccaggcg
actggctgcaccccgggagggcagatcaaccccaactcggggtaccagcacaagaggctg
gaggagtgcctcccaactggggtttacgaatgtaacaagaggtgcaaatgcaacgtcaac
atgtgtaccaaccgcctggtccagcacgggctgcaggtcaggctgcagctgttcaagact
cagaacaagggctggggcatccgctgccttgatgacattgctaagggctccttcgtctgc
atctatgcagggaaaatcctcacggacgacttcgccgacaaagaaggtttagagatgggg
gatgaatactttgccaacctggatcacatcgagagtgtggagaacttcaaggagggctat
gagagtgatgccaagtgctcgtctgacagcagcggggtggacctgaaggacgatgaggaa
gacaacacgggcacggaggagcaggaggagtccaacgaggacagctctgacgacaacttc
tgcaaggacgagggcttcaacaccagctcggtgtggcgcagctacgccacacggcgacag
actcgaggccagaaggagaacgggctcttggagacagcgtctaaagactctgggctcaca
ccgcgggtcggccacgatgaggccgcggctgctgcctcctgtaaactgcccgtgtctgag
gagagctccaagaacaaagtggcctcatggctcagctccaacagtgtggctgacagcttc
caggacaacaacagcacctcgtcctttaagatgagcgaagaggccaaaggctgcagggct
gagcctgccccggggggagcagagggagaggcaaaggcactgaagaaggatgaacctgaa
gattcacgcagacttcccgggctcagcgacatgggcaggatgtacggctacaaccccagc
ccccctaaactggaaggggtgcgcagacccaccagcaaaacagctctgctgcagagcagg
cggcacttggcgctgctgcagctccgtgctgaggacgtgctgaccttatccagcagcacc
gacagcgatggggacaacgggcccaaggtggaagggcagccccaaagcaccgccaacgac
agcgatgacatccagaccatctcatccggctctgaggaggaggaaggggacgagaagaag
aatttgtctggttcagggcccatgaagaggcaggttgcagtgaaatccacacgaggtttt
gccctgaaatccacccacggcatcgccatcaaatccaccaacatggcagcggctgagaag
ggagacagtgctccggtgtgcaaaaccacacggcagttctacgacggagaggagtcctgt
tacatcatcgatgcgaaactggaagggaacctgggccggtacctcaaccacagctgcagc
cccaacctcttcgtgcagaatgtctttgtggacactcacgatctccgcttcccgtgggtc
gccttcttcgccagcaagaggatccgggctggcacggagctgacatgggattataactac
gaggtgggcagcgtggagggcaaagagctgctgtgctgctgcggggccattgagtgcaga
gggaggctgttgtga

DBGET integrated database retrieval system