KEGG   Coturnix japonica (Japanese quail): 107324690
Entry
107324690         CDS       T04297                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04012  ErbB signaling pathway
cjo04068  FoxO signaling pathway
cjo04110  Cell cycle
cjo04115  p53 signaling pathway
cjo04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107324690 (CDKN1A)
   04068 FoxO signaling pathway
    107324690 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107324690 (CDKN1A)
   04115 p53 signaling pathway
    107324690 (CDKN1A)
   04218 Cellular senescence
    107324690 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107324690
NCBI-ProteinID: XP_015740412
LinkDB
Position
26
AA seq 143 aa
MPLAQSRTGPMPCSSKACRNLFGPVDHEQIRNDFEELLRQQLEEAQRRWNFNFETETPLD
GHFKWERVLMAEQPPRVEPGSNGSSAPRRVPSKDGVGGARCGAAQQSSEQTRVGSAQHLK
RGQTTVKDFYSSKRRVVHDKPRL
NT seq 432 nt   +upstreamnt  +downstreamnt
atgccgctggcgcagagcaggaccggcccgatgccgtgcagcagcaaagcgtgcaggaac
ctcttcggccccgtggaccacgaacagatccggaacgacttcgaggagctgctgaggcaa
cagctggaagaagctcagagacgttggaacttcaacttcgagacggagacgcccctggat
gggcacttcaagtgggagagggtcctgatggccgagcagcccccccgggtagagcccggc
agcaacgggagctcagcaccacgcagggtccccagtaaggatggtgtcggtggggctcgt
tgtggggcagcccagcagagctcggagcaaaccagggtcggttctgcacagcacttgaag
cgggggcagaccactgttaaagacttctacagctccaagagaagagtcgtccatgacaag
cccaggctgtga

DBGET integrated database retrieval system