KEGG   Coturnix japonica (Japanese quail): 107325016Help
Entry
107325016         CDS       T04297                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04210  Apoptosis
cjo04625  C-type lectin receptor signaling pathway
cjo04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107325016 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107325016 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107325016 (MAP3K14)
   04672 Intestinal immune network for IgA production
    107325016 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjo01001]
    107325016 (MAP3K14)
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107325016 (MAP3K14)
Protein kinases [BR:cjo01001]
 Serine/threonine kinases: STE group
  Other
   107325016 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 107325016
NCBI-ProteinID: XP_015740952
LinkDB All DBs
Position
27
AA seq 941 aa AA seqDB search
MAVMGIVCHGAPAPPTKQQQELSATKGLHEAASEKQSSVCKVEDSKKAIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGRMAPTCWRGRHRGKARKKRHKKRSKLKIQTVAAGRRGPRTPEQESCTPIPVQED
ETHHSALYRNSFWLSELNKNWLYDPPPFQKPEKVLSAGKLNSVGSQHKTDLHKLISPVQC
LNHVWKLHYQRDNVPQPETVRPFPYNILPPPFPHLDSPIHPMKLNALETYFHHDLNYPDS
EHRLSGLNLGFSFPKCVSQSMKSSLDKVSVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
GLDLKEQLQKADENEGVLLTEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKVEDKQTG
FQCAAKKVQVEHFRAEELTTCAVITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
SGCLPEDRALSYLGQVLEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLVTGNYVPGTETHMAPEVVLGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLQKEPVQRASASELRTKASTALQEVGGVTS
PWKGEYREPRRLALHKESNPQTSLPPAVSPASAAPDPDPAARGCCASPAPPPAPERTQQR
EGTRCNPSRELPRIWDPPPLSSPPLPLKSCSHTERTTTISEQELQQLEIELFLNSLSQPY
SLEEQEQMLSCLSIDSPSVSDASEKNSMKASLSLRDTMSSGIHSWSSQTDGQSFSWNNVL
SRSRHTDTPSCFNGVKIQIRLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKDG
HPVHYDMEVPDSGIELQCTLAPDCSVSWAWRVKHGQLENRP
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggggattgtgtgccatggagctcccgctccgcccaccaagcagcagcag
gagctcagtgccaccaaagggctgcacgaggccgccagcgagaagcaaagcagcgtttgc
aaagtggaggattccaagaaagccatcttccacagccagtggaaaatcctcaacgacgtc
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgcgcgtccatctccattatt
gcccaggcagagtgtgagaacagccaggagttcagccccacgttgtcagagagatccttc
attgcccacagcaaacgttacagccgctcagacagcctcgatcagatcccaaacaatgtg
gcccacgcgacggaggggaggatggctcccacctgctggagggggaggcatcgtggtaag
gcgaggaagaagcgtcacaagaaacgatccaagctgaaaatacaaacagtggctgctggc
agacggggccccagaactccagaacaggagagctgcactcccattcccgtacaggaggat
gaaacacaccacagtgctctctacagaaacagcttttggttatcagaactgaacaagaac
tggctttacgatccacccccgtttcagaaacccgagaaagttctgtccgcaggcaaactc
aattcagtgggcagccagcacaaaactgacctgcacaagctgataagccctgtccagtgc
cttaatcatgtctggaagctgcactaccagagggacaacgtccctcagcctgaaactgtc
cgtccttttccatacaacatcctgccccctccattcccacatctggacagtcctatccat
cccatgaagcttaatgctctggagacatatttccatcacgatctcaattacccagacagt
gagcatcgcttgtctggcctgaacttgggattcagcttccccaagtgcgtcagccagtcc
atgaagagcagcttggacaaggtttctgtggaagaatacttggtggacgccttgaagggc
agcgtgagcctcggggagccgcagaacttggccagccttgccaagacgtggaggggaggc
ggtctggacctgaaggaacagcttcaaaaggcagatgagaatgaaggcgtgctgctcact
gagaaactgaagccggtggattacgagtaccgagaagaggttcactggaccaagtgccac
ggctctctgggcatcggctcctttggagaagtgtacaaagtagaggacaagcagacggga
ttccaatgcgctgccaaaaaggtgcaggtcgaacacttccgtgcagaggagttaacgacg
tgcgcggtgataacgagccctaaagttgtgccgttgtatggtgctgtgaaggagggacct
tgggtgaccatcttcatgaagctgatggagggtggatcactgggtcagctaattaagcag
agcggctgcctgcccgaggacagagccctcagttacctggggcaggtgctggaaggcctg
gagtacctgcacgctcagaacattctccatggagatgtgaaagcggaaaacgtgcttttg
tctgacgatgggagcagagctctgctgtgtgactttggtcactctgctcacctccatcct
gacggcctggggaagtgcttggtcacagggaactacgtgcccggcacggagacacacatg
gctccagaggtggtgctggggaagcgctgcgactccaaggtggacgtgtggagcagctgc
tgcatgatgctgcacatgctgaacgggtgccacccctggacgcagtattacaaccatccc
ctttgtctgaagatcgcgaaggagccgcctcctctgagggaaattccaccttcctgcaac
cccctcactgctgagatcattaaaatggggctgcagaaggagcccgtgcagagggcgtct
gcgtccgagctgaggaccaaggccagcactgcgctgcaagaagtgggaggtgtgacgagc
ccctggaaaggcgaatacagagagccccggcgattggcactgcacaaagagagcaacccg
cagacatccctgccccctgcagtgagcccagcctcggccgctcctgacccagaccctgca
gcccgaggctgctgtgccagccctgcgcctccaccggccccggagcgaacgcagcagcgc
gagggaacccgctgcaaccccagcagggagctgccccggatctgggatcctcctcctctc
tcctcccctcccctccccttgaagagctgcagccacacggagagaacgaccaccatttct
gaacaggagctgcagcagctggagatcgagctgtttctgaacagcctttctcagccgtat
tcactggaagagcaggaacaaatgctttcgtgtctcagcattgacagcccgtctgtgtca
gacgccagtgagaagaactccatgaaggcttccctcagcctgcgggacaccatgagctcc
ggcatccattcctggagcagccagacagacggacagagcttcagctggaacaacgtgctg
agccgcagccgccacacggacacccccagctgcttcaacggagtgaaaatccagatcagg
ttgttgagtggagaaaatttacacatcagggatttccacaggacgaaggtgggagacatc
gccactgggataagcagccagattcccgtccccgccttcagcctggtgacgaaggacggc
caccccgttcactacgacatggaagtccccgactcgggcattgagctgcagtgcaccctg
gccccggactgcagcgtcagctgggcgtggagagtcaaacacgggcagctggagaacagg
ccgtga

DBGET integrated database retrieval system