KEGG   Coturnix japonica (Japanese quail): 107325714Help
Entry
107325714         CDS       T04297                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjo03036]
    107325714 (HDAC7)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107325714 (HDAC7)
Chromosome and associated proteins [BR:cjo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107325714 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 107325714
NCBI-ProteinID: XP_015742332
LinkDB All DBs
Position
LGE22C19W28_E50C23
AA seq 1035 aa AA seqDB search
MRSGGFPGAELAGCSQPQGTALTLSAALVMFSPSSAVTPCTSPRVPQAVPMDLRIGQRVV
KPGSDTALLALKHTQQLQHQLFLASLHQQQVEQLAHQHVRVTMETSHREAEPGQQEQELR
QILNKDKSKRSAVASTVVKQKLAEVILKKQQAAALERTSNPNPPAMPYRTLEPLDPEGPS
PPVLSTFLSPVPSTSLDPPEHFPLRKTASEPNLKVRCKPRKCLDRRKNPLTRKESAPPSL
KRRPPETIDSSPSSSSTPVSGCSSPNDSLPAEHGALPTASSMAHEAPLAQRLMMQESSLA
QFALQSAVSLPAITLGLPATTSARGDGDRRSLSGLAHRVPVLNGPVLTGTHSPMFFPAGL
EQHEAGNPLSPRLQPVIILEPSVTHTPLVAVPGLGTVPFSFAPSLISTERLSLPGHHKPL
GRTRSEPLPQNPKAIQQQLVYQQHHAQFLERLKQQTHLGKRMVKTSEKPRLRQIPSSEDM
EAEGMEAGAESSEQARAHVEPARPGSSGKEPERPQKMLQPQEELILQQAYLWDPYPRVQH
QLLKRQPLADSTMVPTVLAGHRPLSRAQSSPATATVSLPAQDTTSKALSLPVQEQTSKPH
FTTGLVYDSVMLKHQCSCGDNSNHPEHAGRIQSIWSRLQERGLRSQCECLRGRKATLEEL
QCVHTERHVFLYGTNPLNRLKLDNGKLAGILSQRMFVMLPCGGVGVDSDTIWNELHSSNA
ARWAAGSVTELAFKVASRELKNGFAVVRPPGHHADPSTAMGFCFFNSVAIAARQLQQKGK
LSKILIVDWDVHHGNGTQQIFYRDPDVLYISLHRHDDGNFFPGSGAADEVGAGPGEGFNV
NVAWTGGLDPPMGDPEYLAAFRTVVMPIAHEFSPDVVLVSAGFDAADGHPPPLGGYKVSA
KCFGYLTKQLMSLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEESMRQKPN
ANAVRSLEAVIQVQSKYWVAVQRFASKLGCSFLEAQHHEAEEVETVTALASLSVAVMVEK
RPQDEPMEEEEPMNQ
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcggtggcttcccaggagcggaactagctggatgttctcagcctcagggcaca
gctctgactctgtctgcggctctggtgatgttcagcccgtcctctgctgtgaccccgtgc
acctctccacgggtgccccaggccgtccccatggacctgcgcatcgggcagcgtgttgtc
aagcccggctccgacacggcgttactggctttgaagcacacgcagcagctgcagcaccag
ctcttcctcgccagcctgcaccagcagcaagtggagcagcttgcccaccagcacgtcagg
gtgaccatggagacctcacaccgtgaagcagagcctgggcagcaggagcaggagctgcgg
cagatcctcaataaggacaagagcaaacgaagtgcagtggccagcacagtggtgaagcag
aaactggctgaggtcatcctgaagaagcagcaggcagcagctttggaaagaaccagcaac
cccaaccctccagcaatgccatacaggactctggagcctctggatcctgaaggtccttcc
cctcctgtactcagcaccttcctgtccccggttcctagcacttctcttgatcccccagag
cattttccactccggaagacagcgtctgagcccaacctgaaggtgcgttgcaagcccagg
aagtgcctggaccgccgcaagaaccccctgacacggaaggaaagtgctcccccctctctg
aaaaggagaccacctgagaccattgattcctccccaagcagcagcagcaccccagtgtct
ggctgcagctctcccaacgacagcctccctgccgagcacggagccctccccactgcctcc
agcatggcccacgaggcacccctggcccagcgcctgatgatgcaggagagctccttggcc
cagtttgccctgcagagcgcagtctcccttcctgccatcaccctgggattgccagctacc
actagtgccaggggagatggggatcgtcgctctctctctggcctggcacaccgggtgcct
gtgctgaacgggcctgtcctcacaggcacacactcacccatgttcttcccagctggcttg
gagcagcatgaggctgggaaccctttgtcccctcggctccagcctgtcatcatcctcgag
ccctcagtcacccacactccacttgtggcagttccaggtctggggacagtccctttctcc
ttcgccccatcgctcatctctacagagcgcctgtcgctcccaggccaccacaaaccactg
ggcaggacccgctcggagcccctgccccagaaccccaaggccatccagcagcagctggtg
taccagcagcaccatgcccagttcctggagaggctcaagcaacagacgcacctgggcaag
cgcatggtgaaaaccagcgagaagccccggctgcggcagatcccctcctcagaggacatg
gaggctgaggggatggaggctggggctgagagcagtgagcaggcgagggcacatgtggag
cctgcacggccagggagcagcgggaaggagcctgagaggcctcagaagatgctgcagcct
caggaggagctcatcctccagcaggcctatctctgggacccctacccacgtgtgcagcac
cagctactcaagcggcagcccctggctgactccaccatggtcccaaccgtcctggcaggg
cacagacctctctccagggcccagtcatctcctgccaccgcgactgtctccctccctgcc
caggatacaacctccaaagcactctccctgccagtgcaggagcagacctccaagccccat
ttcacaacaggactggtttatgactcggtgatgctcaaacaccagtgctcctgtggtgac
aacagcaaccatccagagcacgcgggtaggattcagagcatctggtcccgactgcaggag
aggggtctgcgcagccagtgtgagtgtctgcggggacgcaaggccaccctggaggagctg
cagtgtgtccacaccgagcgccacgtcttcctctatggcaccaatcccctcaaccgcctg
aaactggacaatgggaagctggcagggattctgtcacagcggatgttcgtcatgctgccc
tgtggaggggtgggggtggacagtgataccatctggaatgagctgcactcctccaatgca
gcccgctgggccgcaggcagcgtcaccgagttggccttcaaagtggccagtagggagctg
aagaatggttttgctgtggtgaggccgcccggacatcacgcggatccatccactgccatg
gggttctgcttcttcaactcggtggccattgctgccaggcagctgcagcagaaagggaaa
ctcagcaagatcctcattgtggactgggatgttcaccacggcaatgggacccagcagatc
ttctacagagaccccgacgttctctacatctctttgcatcgtcacgacgatggaaacttc
ttccctggcagcggggctgctgatgaggttggtgctggccctggtgagggatttaatgtc
aacgtagcctggactggaggccttgacccccccatgggtgaccctgagtatctggctgct
ttcaggacggtggtgatgccaatcgcacatgaattctcccccgatgtggtgttggtgtca
gctggcttcgatgcagctgatggccacccaccacccctgggtggctacaaagtctctgct
aaatgttttggctacctgaccaagcagctgatgagcctggctgggggccgcgtcgtcctg
gcccttgaaggaggccacgacctcactgccatctgtgatgcttctgaagcctgtgtatca
gccttgctgggcaatgagctggaccctctcccagaagaaagcatgaggcagaagcccaat
gccaacgctgtgcgctccttggaagccgtgatccaggtccaaagtaaatactgggtggct
gtgcagcgttttgcctccaaactgggctgctccttcctggaggctcagcaccacgaggca
gaagaggtagagacggtcacagccttggcctccctctcagtggctgtgatggtggagaag
aggccacaagatgagcctatggaggaggaggagcccatgaaccagtga

DBGET integrated database retrieval system