KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_06265Help
Entry
A911_06265        CDS       T02264                                 

Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp00061  Fatty acid biosynthesis
cjp00620  Pyruvate metabolism
cjp00640  Propanoate metabolism
cjp01100  Metabolic pathways
cjp01110  Biosynthesis of secondary metabolites
cjp01120  Microbial metabolism in diverse environments
cjp01130  Biosynthesis of antibiotics
cjp01200  Carbon metabolism
cjp01212  Fatty acid metabolism
Module
cjp_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A911_06265
   00640 Propanoate metabolism
    A911_06265
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A911_06265
Enzymes [BR:cjp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     A911_06265
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     A911_06265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 ATP-grasp_5 DUF3182
Motif
Other DBs
NCBI-ProteinID: AFU43336
LinkDB All DBs
Structure
PDB: 

Position
complement(1222488..1223819)
Genome map
AA seq 443 aa AA seqDB search
MEIKSILIANRGEIALRALRTIKEMGKKAICVYSEADKDALYLKYADASICIGKARSSES
YLNIPAIITAAEIAEADAIFPGYGFLSENQNFVEICAKHNIKFIGPSVEAMNLMSDKSKA
KQVMQRAGVPVIPGSDGALAGAEAAKKLAKEIGYPVILKAAAGGGGRGMRVVENEKDLEK
AYWSAESEAMTAFGDGTMYMEKYIQNPRHIEVQVIGDSFGNVIHVGERDCSMQRRHQKLI
EESPAILLDEKTRTRLHETAIKAAKAIGYEGAGTFEFLVDKNLDFYFIEMNTRLQVEHCV
SEMVSEIDIIEQMIKVAEGYALPSQESIKLNGHSIECRITAEDSKTFLPSPGKITKYIPP
AGRNVRMESHCYQDYSVPPYYDSMIGKLVVWAEDRNKAIAKMKVALDELLISGIKTTKDF
HLSMMENPDFINNNYDTNYLARH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaagcatattaattgctaatcgtggagaaatagcactgcgtgctttaaga
acgattaaagaaatgggtaaaaaagcaatttgtgtgtattctgaagcagataaagatgct
ttgtatttaaaatacgctgatgcaagcatttgtataggcaaagcaagaagttctgaaagc
tatttaaatatcccagctattattacagcagctgaaattgctgaagcagatgcgattttt
ccaggatacggatttttaagtgaaaatcaaaattttgttgaaatttgtgctaaacataac
atcaaatttataggtccttctgtggaagctatgaatttaatgagtgataaatcaaaagca
aaacaagtcatgcaaagagcaggcgtacctgtgatcccaggaagcgatggggctttggca
ggagctgaagcagctaaaaaacttgccaaagaaataggttatcctgtgattttaaaagca
gctgcaggtggtggtggtcgtggtatgcgtgtggttgaaaatgaaaaagatcttgaaaaa
gcgtattggtcggctgaaagcgaggctatgacagcatttggcgatggaactatgtatatg
gaaaaatacatacaaaatccacgccatatagaagtgcaggttataggagatagttttggc
aatgtgattcatgtgggcgaaagagattgttctatgcaaagacgccatcaaaaacttata
gaagaatcccctgcgattttgcttgatgaaaaaacacgcactagacttcatgaaactgct
attaaggcagctaaagctataggatatgaaggtgcgggaacttttgagtttttggtagat
aaaaatttggatttttattttatagaaatgaatacgcgtttgcaagttgaacactgtgta
agtgaaatggtaagtgagattgatatcatagaacaaatgattaaagtagcagaaggttat
gctttaccatctcaagaaagtattaaattaaatgggcattctatagaatgtagaatcaca
gctgaagattccaaaactttcttgccaagtccaggtaagattactaaatacattccaccc
gcaggacgcaatgtcagaatggaaagtcattgttatcaagactatagcgtgcctccttat
tatgattctatgataggcaaacttgtagtttgggcagaagatcgtaataaagctattgca
aaaatgaaagtagctttagatgagttgcttataagtgggataaaaacaaccaaagatttt
catctttctatgatggaaaatcctgattttattaataataactacgatacaaattatctt
gcaagacattaa

DBGET integrated database retrieval system