KEGG   Campylobacter jejuni subsp. jejuni 35925B2: UC78_1331Help
Entry
UC78_1331         CDS       T03745                                 

Gene name
katA
Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
cjq  Campylobacter jejuni subsp. jejuni 35925B2
Pathway
cjq00630  Glyoxylate and dicarboxylate metabolism
cjq01100  Metabolic pathways
cjq01110  Biosynthesis of secondary metabolites
cjq01130  Biosynthesis of antibiotics
cjq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cjq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    UC78_1331 (katA)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    UC78_1331 (katA)
Enzymes [BR:cjq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     UC78_1331 (katA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AJP35811
LinkDB All DBs
Position
1306863..1308287
Genome map
AA seq 474 aa AA seqDB search
MKKLTNDFGNIIADNQNSLSAGAKGPLLMQDYLLLEKLAHQNRERIPERTVHAKGSGAYG
EIKITADLSAYTKAKIFQKGEVTPLFLRFSTVAGEAGAADAERDVRGFAIKFYTKEGNWD
LVGNNTPTFFIRDAYKFPDFIHTQKRDPRTHLRSNNAAWDFWSLCPESLHQVTILMSDRG
IPASYRHMHGFGSHTYSFINDKNERFWVKFHFKTQQGIKNLTNQEAAELIAKDRESHQRD
LYNAIENKDFPKWKVQVQILAEKDIEKLGFNPFDLTKIWPHSLVPLMDIGEMILNKNPQN
YFNEVEQAAFSPSNIVPGIGFSPDKMLQARIFSYPDAQRYRIGTNYHLLPVNRAKSEVNT
YNVAGAMNFDSYKNDAAYYEPNSYDNSPKEDKSYLEPDLVLEGVAQRYAPLDNDFYTQPR
ALFNLMNDDQKTQLFHNITASMEGVDEKIITRALEHFEKISPDYAKGIKKALEK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgactaacgattttggaaacattatagccgataaccaaaattcattaagc
gcaggcgcaaaaggacctttacttatgcaagattatcttttgcttgaaaaacttgctcat
caaaatagagaaagaattccagaaagaaccgttcatgctaagggaagtggagcttatggc
gaaataaaaattacagcagacttaagtgcttataccaaagctaaaatttttcaaaaaggc
gaagttactccattatttttacgcttttcaacagtagcaggtgaagcaggtgcagcagat
gctgaacgcgatgtgagaggttttgctattaaattttacaccaaagaaggaaactgggat
ttagtaggaaataatactccaactttttttatccgtgatgcttataaattccctgatttt
atccatactcaaaaaagagatccaagaacacatttaagaagcaataatgctgcttgggat
ttttggagtttatgtcctgaaagcttacatcaagtaaccattcttatgagtgatagagga
attcctgcaagttatcgtcatatgcatggatttggaagccatacttatagttttattaat
gataaaaatgaaagattttgggtgaaattccattttaaaacccaacaagggattaaaaat
cttaccaaccaagaagctgcagagcttatagcaaaagatagagaaagtcatcaaagagat
ctctataatgctatagaaaataaagattttccaaaatggaaagttcaagttcaaattctt
gctgaaaaagatatagaaaaacttggatttaatccttttgatttaacaaaaatttggcct
catagtcttgtacctttgatggatataggcgaaatgattctaaataaaaatcctcaaaat
tatttcaatgaagttgaacaagctgcctttagtccaagcaatatcgttcctggaattggt
tttagccctgataaaatgttgcaagctagaattttttcatatcctgatgcacaaagatat
agaataggaactaattatcatcttttgcccgtaaatcgtgcaaaaagcgaagtgaatact
tacaatgtcgctggtgctatgaattttgatagttataaaaatgatgcagcctattatgaa
ccaaacagctatgataatagcccaaaagaagacaaaagctatcttgaacctgatttagtc
ttagaaggcgtagcacaaagatatgctccactagataatgacttttatactcaaccaaga
gctttatttaatcttatgaatgatgatcaaaaaactcaactttttcataatattaccgct
tctatggagggagttgatgaaaaaattatcactagagctttagaacattttgaaaaaatt
tcacctgattatgcaaaaggaattaaaaaagctttagaaaaataa

DBGET integrated database retrieval system