KEGG   Campylobacter jejuni RM1221: CJE0322Help
Entry
CJE0322           CDS       T00227                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00061  Fatty acid biosynthesis
cjr00780  Biotin metabolism
cjr01100  Metabolic pathways
cjr01212  Fatty acid metabolism
Module
cjr_M00083  Fatty acid biosynthesis, elongation
cjr_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cjr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CJE0322 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CJE0322 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cjr01004]
    CJE0322 (fabZ)
Enzymes [BR:cjr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CJE0322 (fabZ)
Lipid biosynthesis proteins [BR:cjr01004]
 Fatty acid synthase
  Component type
   CJE0322 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AAW34912
UniProt: Q5HWJ3
LinkDB All DBs
Structure
PDB: 

Position
286903..287343
Genome map
AA seq 146 aa AA seqDB search
MIDVMQIQEILPHRYPFLLVDKITELKVKEVVLGYKNISISDHVFMGHFPGHPIYPGVLI
LEGMAQTGGVLAFESMEDKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMSVVKNRGNM
WIFKGQAFVDGNLVAEAELKAMIVDK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtaatgcaaattcaagaaatcttaccacaccgttatccttttttactggta
gataaaattacagaattaaaagttaaagaagtggtgctaggatataaaaacatcagtata
agtgatcatgtttttatgggacattttccagggcatcctatttatcctggagttttgatt
ttagaaggtatggctcaaacaggtggagttttagcttttgaaagtatggaagataaagtg
gatccaaaaagtaaagtagtttatttcacaggcatagatggagcaaaatttagaaatcct
gtgcgtcctggagataggcttgattatgaaatgagcgtggttaaaaatcgtggtaatatg
tggatttttaaagggcaagcttttgtagatggaaatttagttgcagaggccgagcttaaa
gctatgatagtggataaataa

DBGET integrated database retrieval system