KEGG   Campylobacter jejuni RM1221: CJE0488Help
Entry
CJE0488           CDS       T00227                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00020  Citrate cycle (TCA cycle)
cjr00190  Oxidative phosphorylation
cjr00650  Butanoate metabolism
cjr01100  Metabolic pathways
cjr01110  Biosynthesis of secondary metabolites
cjr01120  Microbial metabolism in diverse environments
cjr01130  Biosynthesis of antibiotics
cjr01200  Carbon metabolism
Module
cjr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJE0488 (sdhA)
   00650 Butanoate metabolism
    CJE0488 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CJE0488 (sdhA)
Enzymes [BR:cjr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CJE0488 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CJE0488 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like DAO Thi4 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AAW35076
LinkDB All DBs
Position
443615..445345
Genome map
AA seq 576 aa AA seqDB search
MDKDINLPSCDVLVIGSGGAGLRAAAAVRKENPKLSVVVATKMMPSRNATCMAEGGINGV
TDFSNGDSYKLHAYDTIKGGAYLVDQDAALKFCELAGKAIFNMDFIGTLFSRNEQGGVAQ
RLMGGASKKRCNYSADKTGHILMHSCLDDAISSGVKFLMDHELLDIGVVDGKCEGVVLRD
IQSGGIYPVLCKALVIATGGYTRIFYNRTSTPFIATGDGVAAALRAGLGFEDPEMIQFHP
TGVANGGTLITEAARGEGGYLLNNRGERFMKNYHEKMELAPRDVVARAIETEIREGRGYG
EGLGAYVLCDVRHLGKEKILKDLPKIRHTAMLFENIDLVDTPVPIRPTAHYSMGGIEVAK
FEDMSTKIAGIYVGGEASCISIHGANRLGGNSLADAVVTGHLAGIGATNYAKDASFGKGA
KTHELAQKWQVRFKEITNNGGNGQEMYELREELGSQNWDNMGIFRTQEKLDLLAKKLEDI
QARYEKIRIPNPNEVMNTAFTDYVELGNLILLSRCACLAARNRLESRGAHTREDYPKRDD
KNFLKHSIVNLENDELKLSYKDVVVTEFSLDGRRVQ
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggataaagatataaatttaccttcttgcgatgttttggtaattggatcaggtggagca
ggtttgcgtgctgcagccgcagtgagaaaagaaaatccaaaattaagcgttgtagtagct
acaaagatgatgccatcgcgtaacgcaacttgtatggcagagggtggaattaatggagtt
actgatttttctaatggagattcctataaattacatgcttatgatactattaaaggcgga
gcttatttggtagatcaagacgcggctttaaaattttgcgaattagctggaaaggctatt
tttaatatggattttataggaaccttgttttcaagaaatgagcaaggtggagtagctcag
cgtttaatgggaggagcttctaagaaacgctgtaactattctgcagataaaacaggtcat
attttaatgcattcttgtttagatgatgctattagtagtggtgtgaaatttttaatggat
catgaacttttggatataggtgttgtggatggaaaatgcgagggtgtcgttttaagagat
atacaaagcggtggaatttatcctgtgttatgcaaagctttggtgattgctacaggggga
tacacaaggatattttataatagaacttcaactccttttattgccacaggagatggtgtg
gcagctgctcttagagcaggacttggttttgaagatcctgagatgatacaatttcaccca
acaggagttgcaaatggtggaactcttattacagaagcggcgcgcggtgaagggggatat
cttttaaataatcgtggtgagcgttttatgaaaaattaccatgaaaaaatggagcttgca
ccgcgagatgtggttgcgcgtgctatagaaacagaaattcgtgaaggtagaggttatggc
gagggacttggagcttatgttttgtgcgatgtacgccacttaggaaaagaaaaaatttta
aaagatttaccaaaaattcgtcacactgcaatgctttttgaaaatattgatttagtagat
actcctgtacctatccgtccaacggcacattattctatgggtggaattgaagtggctaaa
tttgaagatatgagtactaaaattgctggaatttatgtaggtggagaagcttcttgcatt
tctatacatggagctaatagactagggggaaattctttagccgatgcagttgtaacaggg
catttagcaggcattggtgcgacaaattatgctaaagatgcaagttttggaaaaggggca
aaaactcatgaacttgctcaaaaatggcaggttagatttaaagaaattacaaataatggc
ggaaatggtcaagaaatgtatgaattgcgagaagagctaggaagtcaaaattgggataat
atggggatttttagaactcaagaaaaactcgatcttctagcaaaaaaattagaagatata
caagcgagatatgaaaaaattcgtattccaaatcctaatgaagtgatgaatactgctttt
acagattatgtagagcttggtaatttgattttactttctcgctgtgcttgtttagcagct
agaaatagacttgaaagccgtggggctcatactagagaagattatccaaagcgagatgat
aaaaatttcttaaaacatagcattgtaaatttagaaaatgatgaattaaaacttagttat
aaagatgtcgtggtaactgagttttcacttgatggaaggagagtacaatga

DBGET integrated database retrieval system