KEGG   Campylobacter jejuni RM1221: CJE0489Help
Entry
CJE0489           CDS       T00227                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00020  Citrate cycle (TCA cycle)
cjr00190  Oxidative phosphorylation
cjr00650  Butanoate metabolism
cjr01100  Metabolic pathways
cjr01110  Biosynthesis of secondary metabolites
cjr01120  Microbial metabolism in diverse environments
cjr01130  Biosynthesis of antibiotics
cjr01200  Carbon metabolism
Module
cjr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJE0489 (sdhB)
   00650 Butanoate metabolism
    CJE0489 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CJE0489 (sdhB)
Enzymes [BR:cjr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CJE0489 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CJE0489 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_9 Fer4_17 Fer4_7 Fer2 Fer4_10 Fer4_16 Fer4 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AAW35077
LinkDB All DBs
Position
445342..446307
Genome map
AA seq 321 aa AA seqDB search
MKIIIDRFNGKEKYEQSYDIDDKDIQGKTLLSLLLFIKKTKDITLNFTASCQSAICGACA
VRVNGHSYLACDTKMQDLLKEYDNPSSIRISPLGNFRVISDLIVDWEPSIENLRKIRPAM
VAKNEFSAEKGCKQSQEEFDRISKQWDCILCGSCASECNKLEADSSDYMQPFVFTHAWRA
AADSRGKDPMLHVKPSVMNGLWLCVHCQECADRCPKGISSVSDIANLRVMAIKKGLNEGL
GPDHAEAFYKDLVEGSGRLNEIYLALRSEGVIGSMGKTDIAFKLMRAGKMNPMHVFGEGE
IEGHKDLVKMIKAAQEAAVKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcatcatagatcgttttaatggcaaggaaaaatatgaacaaagttatgatatt
gatgataaggatatacaaggaaaaactctgctctctcttttactttttattaaaaaaaca
aaagatattactttaaattttaccgcctcttgtcaatctgcgatttgtggggcttgtgca
gttcgtgtgaatgggcattcttatcttgcttgtgatactaaaatgcaagatttattaaaa
gaatatgataatccttcaagtatacgcatttctccgcttggaaattttagagtaatttct
gatttaattgtggattgggagccttctatagaaaatttaagaaaaattcgtcctgccatg
gtggcaaaaaatgaattttcagcggaaaagggctgtaaacaaagtcaagaagaatttgat
cgtattagcaagcaatgggattgtattttatgtggtagctgtgcttcagagtgtaataaa
ttagaagcagatagtagcgattatatgcaaccttttgtttttactcatgcttggcgtgca
gcggcggactctcgaggtaaggatcctatgttgcatgtaaaacccagcgtaatgaatgga
ctttggctttgtgttcattgtcaagagtgcgctgatcgttgtccaaagggtataagttca
gtaagtgatatagcaaatttaagagtgatggcgattaaaaaaggtttaaatgaaggctta
gggcctgatcatgctgaagctttttataaagatttagttgaaggttcaggacgcttgaat
gaaatttatcttgctttgcgttctgagggtgttataggttctatgggtaaaacagatata
gcttttaaacttatgcgtgcaggaaaaatgaatcctatgcatgtttttggcgagggtgaa
atagaagggcataaagatttggttaaaatgataaaggcggcacaagaagctgctgttaag
gagtaa

DBGET integrated database retrieval system