KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0611Help
Entry
C8J_0611          CDS       T00597                                 

Gene name
pbpC
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00550  Peptidoglycan biosynthesis
cju01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cju00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C8J_0611 (pbpC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C8J_0611 (pbpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cju01011]
    C8J_0611 (pbpC)
Enzymes [BR:cju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C8J_0611 (pbpC)
Peptidoglycan biosynthesis and degradation proteins [BR:cju01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   C8J_0611 (pbpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABV52210
LinkDB All DBs
Position
611846..613654
Genome map
AA seq 602 aa AA seqDB search
MRMRLVVGFILLFFIFLLSRVYYLSIKSNVYYEELAKQNAIKTEFLPPVRGQITDRNGTL
LAINDLGFSISIKPYLSIKKSNKGILDKELSELTNLFPDLNASKLAEIYKRNDSYYNQDF
IKVVDFIPYDEIIPHYSELNLNKTIKIDPVVKRKYPFGKLASHIIGYVGKANLQDVQENE
IAKLSNYTGKSGIERYYNDILQGEKGTRVYKVNALNQEVEQLSYTPAMSNDIELTIDIEL
QSYLTSLFEGNAGAAIIMNVNDGSILAAGSFPEYDLNPFVTGISFKDWDELSNSLDHPFT
NKLINGYYPPGSVVKMGVGLSFLNSKNISPSTQYVCNGSIELGGRFFRCWNRSGHGPVDL
KHAIKYSCDVYFYNGSLQVGIDQISETLSRIGFGAKTGVDLPSEFVGTLPSKEWKMQRYR
QSWFQGDTLNTAIGQGNFLATPMQIARYTAQIAKGGEVIPHFLKSIENNNNTTIENQMDE
NKKEIFTLFEKSQLPYIRDAMYAVANEQGGTSYRYLHNLDVKVAAKTGTAQVVGFSQTDK
NRVDEKQFEYYTRSHAWLTSYAPYSKPKYVVTVLLEHGGRNITSGATVAKIYQKMIELGY
FK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgcgtttagttgttggatttatactattgttttttatatttttattaagtcgt
gtgtattatttgagtataaaatcaaatgtatattatgaagagcttgctaaacaaaatgcc
ataaaaactgaatttttaccacctgttaggggtcaaattacagatagaaatggaacttta
ttggctattaatgatttgggttttagtatttctattaaaccttatttgagtattaaaaag
tcaaataaaggaattttagataaagaattatctgaacttacaaatttatttcccgattta
aatgctagtaaattagcagaaatttataagagaaatgattcttactataatcaagatttt
attaaagtagtagattttataccctatgatgagattattccgcattattcagagttaaat
cttaataaaacaataaaaatagatcctgttgtaaaaagaaaatatccttttggaaaattg
gcttcgcatattattgggtatgtaggtaaggcaaatttgcaagatgttcaagaaaatgaa
atagcaaaactttctaactatacgggaaaaagcggtatagaacgctattataatgatatt
ttacaaggagaaaaaggaactagggtttataaggttaatgccttaaatcaagaagtagaa
cagctttcttacactcctgctatgtctaatgatatagaacttacgatagatatagagctt
cagtcttatttaacttcattgtttgaagggaatgctggagctgctataattatgaatgta
aatgatggatctattttagctgcagggagtttccctgaatatgatcttaatccttttgta
acagggatttcttttaaggattgggatgagctttcaaatagtcttgatcatccttttaca
aataaacttataaatggatattatcctccaggttctgttgtaaaaatgggagtagggctt
tcttttttaaattctaaaaatattagcccgtcgactcaatatgtttgcaatggaagcatt
gagcttggaggcaggttttttagatgttggaatcgatcgggccatggacctgtggattta
aaacatgcgataaaatatagttgtgatgtttatttttataatggcagtttgcaagttgga
atcgatcaaataagtgaaactttatctcgcattggctttggagcgaaaacaggggtagat
ttacctagtgaatttgtaggaactttaccaagcaaagaatggaagatgcaaagatataga
caatcttggtttcaaggtgatactttaaatacagctataggtcaaggtaattttcttgca
acacctatgcaaattgctagatatacggctcaaatcgcaaaaggtggagaggttatacct
cattttttaaaaagcatagaaaataataataatacaactatagaaaatcaaatggatgaa
aataaaaaagaaatttttactttatttgaaaagagtcaattgccttatataagagatgca
atgtatgctgttgctaatgagcaaggaggaacttcttatcgttatttgcataatcttgat
gtgaaagttgcagcaaaaacaggaactgctcaggttgtgggattttcacaaacagataaa
aatagggtcgatgaaaaacaatttgagtattatactagatctcatgcgtggcttacttct
tatgctccttattctaagccaaaatatgtagttaccgttcttttggaacatggtgggaga
aatattacttcaggggcaactgtagctaaaatttatcaaaaaatgattgaacttggatat
tttaaataa

DBGET integrated database retrieval system