KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0749Help
Entry
C8J_0749          CDS       T00597                                 

Gene name
ddlA
Definition
(GenBank) putative D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00473  D-Alanine metabolism
cju00550  Peptidoglycan biosynthesis
cju01100  Metabolic pathways
cju01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cju00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    C8J_0749 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C8J_0749 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    C8J_0749 (ddlA)
Enzymes [BR:cju01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C8J_0749 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cju01011]
 Precursor biosynthesis
  Amino acid ligase
   C8J_0749 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABV52348
UniProt: A8FLL1
LinkDB All DBs
Position
complement(754453..755493)
Genome map
AA seq 346 aa AA seqDB search
MKFAILFGGNSYEHEISIVSAVVLKKVINQNLEFVFCDEERRFYHIPSEKMNSKTFSTKA
YKNEKELFIKQGGFFSKGFLKENKLECECVINLIHGRDGEDGKIAALFEFYSIKFIGPRL
EASVLSFNKELTKLYAKSVGVKTLDYTMLRKNQNSKEKLSFPCIIKPARLGSSIGISIVK
DEKDLEYAKDVGFEFDNDLVVEEFKNNIKEYNLAGCMINDEFVFSIIEEPKKKEFLDFEQ
KYLSFSGHNELIEADLSEELKEKLKDSFKKIYNPLFKGALIRCDFFILDNEVYLNEINPN
PGSLANYLFKDFNTTLNALADQISLEKMIKINYNFLHSINGQKGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcaatactttttggcggaaattcttatgaacatgagatcagtatagtaagt
gctgtagtacttaaaaaagttatcaatcaaaatttagaatttgttttttgcgatgaagaa
agaagattttatcacattccaagcgaaaaaatgaattctaaaacttttagcaccaaagct
tataaaaatgaaaaagaactcttcatcaaacaaggaggtttttttagcaaaggcttttta
aaagaaaataaactagagtgcgaatgcgtgatcaatcttatccatggtagagatggagaa
gatggaaaaattgcggctttatttgagttttattctattaaatttataggacctaggctt
gaagctagtgtattatctttcaacaaagaacttaccaaactttatgccaaaagcgttggt
gtaaaaacacttgattataccatgctaagaaaaaatcaaaactctaaagaaaagcttagt
tttccttgtattatcaaacctgcaagacttggaagtagtataggtattagcatagtaaaa
gatgaaaaagatttagaatacgccaaagatgtaggttttgaatttgacaatgatcttgta
gtagaagaatttaaaaacaatatcaaagaatacaatcttgcaggatgtatgatcaatgat
gagtttgttttttccattatagaagagccaaagaaaaaagaatttttagactttgaacaa
aaatatcttagcttttcaggacacaatgaacttatagaagcggatttaagcgaagaatta
aaagaaaaactcaaagacagttttaaaaagatctacaatcctttgtttaaaggtgcttta
atacgctgcgatttttttatactggataatgaagtatatttaaatgaaatcaacccaaat
cctggttctttggctaattatctttttaaagattttaataccactttaaacgctttagct
gatcaaatttcacttgaaaaaatgataaaaatcaattacaacttccttcactccatcaac
ggacaaaaaggaaaattataa

DBGET integrated database retrieval system