KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1141Help
Entry
C8J_1141          CDS       T00597                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00970  Aminoacyl-tRNA biosynthesis
cju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cju00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C8J_1141 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cju03029]
    C8J_1141 (gatB)
Enzymes [BR:cju01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C8J_1141 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C8J_1141 (gatB)
Mitochondrial biogenesis [BR:cju03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C8J_1141 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey CH
Motif
Other DBs
NCBI-ProteinID: ABV52740
UniProt: A8FMQ3
LinkDB All DBs
Position
complement(1146623..1148041)
Genome map
AA seq 472 aa AA seqDB search
MFEVVIGLEVHTQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPGALPVLNEEAVKKAIA
FGKAVNATINKKSVFNRKNYFYPDLPKAYQISQFDIPIVEKGELFINVKGENKRIGITRA
HLEEDAGKNIHENNFSKVDLNRAGTPLLEIVSEPELRSSDEAVAYLKKLHSIIRFLDISD
ANMQEGSFRCDANVSIRPKGDTKLYTRVEIKNLNSFRFIQKAIEYEVKRQSEAWEDGTYE
QEVVQETRLFDTTNLVTRSMRGKEEAAEYRYFPDPDLLPVLLKDEFLDIKIPELPDEKKA
RFIDELGIKESDAEVLISSLEMSRFFESLISQNLNSKLCVNWLNTELMGLLKGELTIENS
PVDAQKLGVLIKRIEDGTISAKAAKDVLAFVFENTSVEIDEAIEKLGLKQVSDDSAIEAV
IEQILNANADKVAEYKSGKDKLFGFFVGQTMKEGKGAFNPAKVNEILKTKLG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagtagttataggtcttgaagttcatactcagttaaatacaaaaacaaaaatc
ttttgctcatgtgcaacttcttttggagaagctccaaataccaatgtttgtcccacttgt
ttggccttaccaggagctttgcctgttttaaatgaagaggctgtaaaaaaagctatagct
tttggaaaagctgtcaatgcaacaattaataaaaaaagtgtttttaatcgtaagaattat
ttttatccagatttacctaaagcctatcaaatttcacaatttgatatccctatagtagaa
aaaggtgagctttttatcaatgtaaagggtgaaaataaacgcataggtattacaagagca
cacttagaagaagatgcaggtaaaaatatccatgaaaataatttttctaaagtggattta
aatcgtgcaggaactcctttgcttgagattgtcagtgagcctgagcttagaagtagcgat
gaggcggtggcttatcttaaaaaacttcattctattatacgctttttagatatttcagat
gcaaatatgcaagaaggaagttttagatgcgatgcaaatgttagtataaggcctaagggc
gatacaaaactttatactagagtagagattaaaaatcttaattcttttcgttttatccaa
aaagccatagaatatgaggtaaaaagacaaagtgaggcttgggaagatggaacttacgaa
caagaagtagttcaagaaaccagactttttgatacaacaaatttagttacaagaagtatg
cgtggcaaagaagaagcggctgaatatcgttattttccagaccctgacttgcttcctgtt
ttgttaaaagatgagtttttggatattaaaattcctgaacttcctgatgagaagaaagca
cgctttatagacgagcttggtataaaagaaagtgatgccgaggttttaatcagttcttta
gaaatgagtcgtttttttgaaagtcttatttctcaaaatttaaattctaagctttgcgta
aattggttaaatactgaacttatgggacttttaaaaggagaattgactatagaaaattct
cccgtagatgctcaaaagcttggagttttaattaaacgcatagaagatggcaccatcagt
gcaaaagcggctaaagatgtcttagcttttgtatttgaaaatactagcgtggaaattgat
gaagctatagaaaagctaggacttaagcaagtaagtgatgattcagccatagaagcggtg
attgaacaaattttaaatgcaaatgccgataaggttgcagagtataaaagtggtaaagac
aagctttttggattttttgtgggtcaaacaatgaaagaaggcaaaggagcttttaatcct
gcaaaagtaaatgaaattttaaaaacaaagcttggttga

DBGET integrated database retrieval system