KEGG   Campylobacter jejuni subsp. jejuni MTVDSCj20: MTVDSCj20_0636Help
Entry
MTVDSCj20_0636    CDS       T03388                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
cjv  Campylobacter jejuni subsp. jejuni MTVDSCj20
Pathway
cjv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cjv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MTVDSCj20_0636 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjv02000]
    MTVDSCj20_0636 (pstB)
Enzymes [BR:cjv01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     MTVDSCj20_0636 (pstB)
Transporters [BR:cjv02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    MTVDSCj20_0636 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 AAA_16 RsgA_GTPase NB-ARC AAA_29 AAA_23 AAA_14 AAA_24 G-alpha Rad17 AAA_18 ATPase_2 AAA_30
Motif
Other DBs
NCBI-ProteinID: AII24359
UniProt: A0A0B6UVW9
LinkDB All DBs
Position
611394..612134
Genome map
AA seq 246 aa AA seqDB search
MIAKTTNLNLFYGKKQALFDINMQIEQNKITALIGASGCGKSTFLRCFNRMNDKIAKIDG
LVEIEGKDVKNQDVVALRKNVGMVFQQPNVFVKSIYENISYAPKLHGMIKNKDEEEALVV
DCLQKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIKPKLLLLDEPTSALDPISSGV
IEELLKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELIEFGESKEFFENPKQEKTKAY
LSGAFG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgatagcaaaaacaacaaatttaaatttattttatggaaaaaaacaagctttatttgat
atcaatatgcaaatagaacaaaacaaaattaccgcactcatcggtgcttctggatgtggt
aaatccacttttttgcgttgttttaacagaatgaatgataaaatcgcaaaaatcgatggt
ttagtggaaattgaaggaaaagatgttaaaaatcaagatgtagtagccttgcgtaaaaat
gtaggcatggtttttcaacaacctaatgttttcgtaaaaagcatttatgaaaacatctct
tatgcaccaaaacttcatggtatgattaaaaacaaagatgaagaagaagctttggtggtg
gattgtttgcaaaaagtagggctttttgaagaggttaaagataaattaaagcaaaatgcc
ctagctctttcaggcggacaacagcaacgcctttgtattgcaagagctttagcaataaaa
cctaagctcttgcttttagatgagccaacttccgcacttgatcctattagctcaggtgtt
atagaagagcttttaaaagaattaagtcataatctttctatgatcatggttacgcataat
atgcaacaaggtaaacgcgtggctgattatactgcattttttcatctaggcgagcttata
gaatttggtgaaagtaaagaattttttgaaaatccaaaacaagaaaaaaccaaggcttac
ttaagcggtgcttttggataa

DBGET integrated database retrieval system