KEGG   Campylobacter jejuni subsp. jejuni MTVDSCj20: MTVDSCj20_0807Help
Entry
MTVDSCj20_0807    CDS       T03388                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cjv  Campylobacter jejuni subsp. jejuni MTVDSCj20
Pathway
cjv00473  D-Alanine metabolism
cjv00550  Peptidoglycan biosynthesis
cjv01100  Metabolic pathways
cjv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cjv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MTVDSCj20_0807 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MTVDSCj20_0807 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MTVDSCj20_0807 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cjv01011]
    MTVDSCj20_0807 (ddlA)
Enzymes [BR:cjv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MTVDSCj20_0807 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cjv01011]
 Precursor biosynthesis
  Amino acid ligase
   MTVDSCj20_0807 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AII24522
LinkDB All DBs
Position
complement(784922..785962)
Genome map
AA seq 346 aa AA seqDB search
MKFAILFGGNSYEHEISIVSAVVLKKVINQNLEFVFCDEERRFYHIPSEKINSKTFSTKA
YKNEKELFIKQGGFFSKGFLKENKLECECVINLIHGRDGEDGKIAALFEFYSIKFIGPRL
EASVLSFNKELTKLYAKSVGVKTLDYTMLRKNQNSKEKLSFPCIIKPARLGSSIGISIVK
DEKDLEYAKDVGFEFDNDLVVEEFKNNIKEYNLAGCMINDEFVFSIIEEPKKKEFLDFEQ
KYLSFSGHNELIEADLSEELKEKLKDSFKKIYNPLFKGALIRCDFFILDNEVYLNEINPN
PGSLANYLFKDFNTTLNALADQISLEKMIKINYNFLHSINGQKGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcaatactttttggcggaaattcttatgaacatgagatcagtatagtaagt
gctgtagtacttaaaaaagttatcaatcaaaatttagaatttgttttttgcgatgaagaa
agaagattttatcacattccaagcgaaaaaataaattctaaaacttttagcaccaaagct
tataaaaatgaaaaagaactcttcatcaaacaaggaggtttttttagcaaaggcttttta
aaagaaaataaactagagtgcgaatgcgtgatcaatcttatccatggtagagatggagaa
gatggaaaaattgcggctttatttgagttttattctattaaatttataggacctaggctt
gaagctagtgtattatctttcaacaaagaacttaccaaactttatgccaaaagcgttggt
gtaaaaacacttgattataccatgctaagaaaaaatcaaaactctaaagaaaagcttagt
tttccttgtattatcaaacctgcaagacttggaagtagtataggtattagcatagtaaaa
gatgaaaaagatttagaatacgccaaagatgtaggttttgaatttgacaatgatcttgta
gtagaagaatttaaaaacaatatcaaagaatacaatcttgcaggatgtatgatcaatgat
gagtttgttttttccattatagaagagccaaagaaaaaagaatttttagactttgaacaa
aaatatcttagcttttcaggacacaatgaacttatagaagcggatttaagcgaagaatta
aaagaaaaactcaaagacagttttaaaaagatctacaatcctttgtttaaaggtgcttta
atacgctgcgatttttttatactggataatgaagtatatttaaatgaaatcaacccaaat
cctggttctttggctaattatctttttaaagattttaataccactttaaacgctttagct
gatcaaatttcacttgaaaaaatgataaaaatcaattacaacttccttcactccatcaac
ggacaaaaaggaaaattataa

DBGET integrated database retrieval system