KEGG   Campylobacter jejuni subsp. jejuni MTVDSCj20: MTVDSCj20_1217Help
Entry
MTVDSCj20_1217    CDS       T03388                                 

Gene name
rbn
Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
cjv  Campylobacter jejuni subsp. jejuni MTVDSCj20
Brite
KEGG Orthology (KO) [BR:cjv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    MTVDSCj20_1217 (rbn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AII24915
LinkDB All DBs
Position
complement(1190999..1191805)
Genome map
AA seq 268 aa AA seqDB search
MKNFFTILLNLRDKEILNYAAALSFYTVLSLIPILFVCFSVFTQISSFKAYYEKAKQVIF
AFLIPTQQDVVATYIDTFLKNSVNLGIVGLIAMAFTSLAFFSGYDFVINRITKNEPKGLW
QSISSYWTLLTLVPLGLGLSFYISGFIQQTLDDYKIGFNFFEILPFVIIWGLFFISYSSS
VHKGTLKSLALVSFGAGAIWYIGKNLFVYYVVYNKTYASVYGSFSTILFFFIWIYISWII
YLFGLKLYYFLNYNHNEGNKIRKNTKKS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatttttttactattttgctaaatttgcgtgataaggaaattttaaattatgca
gcagcgcttagtttttatactgtattatctttaatacctattttatttgtatgtttttct
gtttttacgcaaatttctagttttaaagcttattatgaaaaagcaaagcaagtaattttt
gcttttttaataccaacgcaacaagatgttgttgctacctacatcgatacttttttaaaa
aatagtgtaaatttgggtattgtaggtcttattgctatggcatttacttctttagctttt
ttttcaggctatgattttgtaatcaatcgtattactaaaaatgaacctaaaggactttgg
caaagcattagttcttattggactcttttaactcttgttcctttggggcttgggcttagt
ttttatatttcaggttttatccaacaaactttagatgattataaaatagggtttaatttt
tttgaaattttaccctttgtaattatttggggtttattttttatatcttattcaagttct
gttcataagggaactcttaaaagtttagctttagtatcttttggagcgggtgctatttgg
tatataggaaaaaatttatttgtatattatgtggtatataataaaacatacgctagtgtt
tatggatctttttctactattttattcttttttatttggatttatatttcttggattatt
tatctttttgggcttaaactctattattttctaaattacaatcataatgaagggaataaa
attcgcaaaaatacaaagaaaagctag

DBGET integrated database retrieval system