KEGG   Campylobacter jejuni subsp. jejuni 00-6200: PJ18_02165Help
Entry
PJ18_02165        CDS       T03792                                 

Definition
(GenBank) (2Fe-2S)-binding protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjw  Campylobacter jejuni subsp. jejuni 00-6200
Pathway
cjw00020  Citrate cycle (TCA cycle)
cjw00190  Oxidative phosphorylation
cjw00650  Butanoate metabolism
cjw01100  Metabolic pathways
cjw01110  Biosynthesis of secondary metabolites
cjw01120  Microbial metabolism in diverse environments
cjw01130  Biosynthesis of antibiotics
cjw01200  Carbon metabolism
Module
cjw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PJ18_02165
   00650 Butanoate metabolism
    PJ18_02165
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PJ18_02165
Enzymes [BR:cjw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PJ18_02165
    1.3.5.4  fumarate reductase (quinol)
     PJ18_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_9 Fer4_8 Fer4_17 Fer2 Fer4_7 Fer4_10 Fer4_16 Fer4 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AJK72327
LinkDB All DBs
Position
409314..410279
Genome map
AA seq 321 aa AA seqDB search
MKIIIDRFNGKEKYEQSYDIDDKDIQGKTLLSLLLFIKKTKDITLNFTASCQSAICGACA
VRVNGHSYLACDTKMQDLLKEYDNPSSIRISPLGNFRVISDLIVDWEPSIENLRKIRPAM
VAKNEFSAEKGCKQSQEEFDRISKQWDCILCGSCASECNKLEADSSDYMQPFVFTHVWRA
AADSRGKDPMLHVKPSVMNGLWLCVHCQECADRCPKGISSVSDIANLRVMAIKKGLNEGL
GPDHAEAFYKDLVEGSGRLNEIYLALRSEGVIGSMGKTDIAFKLMRAGKMNPMHVFGEGE
IEGYKDLVKMIKAAQEAAVKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcatagatcgttttaatggcaaggaaaaatatgaacaaagttatgatatt
gatgataaggatatacaaggaaaaactctgctctctcttttgctttttatcaaaaaaaca
aaagatattactttaaattttaccgcctcttgtcaatctgcaatttgtggggcttgtgca
gttcgtgtgaatgggcattcttatcttgcttgtgatactaaaatgcaagatttgttaaaa
gaatatgataatccttcaagtatacgcatttctccgcttggaaattttagagtaatttct
gatttaattgtggattgggaaccttctatagaaaatttaagaaaaattcgtcctgccatg
gtggcaaaaaatgaattttcagcggaaaagggctgtaaacaaagtcaagaagaatttgat
cgtattagcaagcaatgggattgtattttatgtggtagctgtgcttcagagtgtaataaa
ttagaagcagatagtagcgattatatgcaaccttttgtttttactcatgtttggcgtgca
gcggcggactctcgaggtaaggatcctatgttgcatgtaaaacccagcgtaatgaatgga
ctttggctttgtgttcattgtcaagagtgcgctgatcgttgtccaaagggtataagttca
gtaagtgatatagcaaatttaagagtgatggcgattaaaaaaggtttaaatgaaggctta
gggcctgatcatgctgaagctttttataaagatttagttgaaggttcaggacgcttgaat
gaaatttatcttgctttgcgttctgagggtgttataggttctatgggtaaaacagatata
gcttttaaacttatgcgtgcaggaaaaatgaatcctatgcatgtttttggcgagggtgaa
atagaagggtataaagatttggttaaaatgataaaggcggcacaagaagctgctgttaag
gagtaa

DBGET integrated database retrieval system