KEGG   Campylobacter jejuni subsp. jejuni 00-6200: PJ18_03250Help
Entry
PJ18_03250        CDS       T03792                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
cjw  Campylobacter jejuni subsp. jejuni 00-6200
Pathway
cjw00550  Peptidoglycan biosynthesis
cjw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cjw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PJ18_03250
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PJ18_03250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cjw01011]
    PJ18_03250
Enzymes [BR:cjw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PJ18_03250
Peptidoglycan biosynthesis and degradation proteins [BR:cjw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   PJ18_03250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AJK72523
UniProt: A0A2J0YPH1
LinkDB All DBs
Position
610570..612375
Genome map
AA seq 601 aa AA seqDB search
MRMRLVVGFILLFFIFLLSRVYYLSIKSNVYYEELAKQNAIKTEFLPPVRGQITDRNGTL
LAINDLGFSISIKPYLSIKKSNKGILDKELSELTNLFPDLNASKLAEIYKRNDSYYNQDF
IKVVDFIPYDEIIPHYSELNLNKTIKIDPVVKRKYPFGKLASHIIGYVGKANLQDVQENE
IAKLSNYTGKSGIERYYNDILQGEKGTRVYKVNALNQEVEQLSYTPAMSNDIELTIDIEL
QSYLTSLFEGNAGAAIIMNVNDGSILAAGSFPEYDLNPFVTGISFKDWDELSNSLDHPFT
NKLINGYYPPGSVVKMGVGLSFLNSKNISPSTQYVCNGSIELGGRFFRCWNRSGHGPVDL
KHAIKYSCDVYFYNGSLQVGIDQISETLSRIGFGAKTGVDLPSEFVGTLPSKEWKMQRYR
QSWFQGDTLNTAIGQGNFLATPMQIARYTAQIAKGGEVIPHFLKSIENNNTTIENQMDEN
KKEIFTLFEKSQLPYIRDAMYAVANEQGGTSYRYLHNLDVKVAAKTGTAQVVGFSQTDKN
RVDEKQFEYYTRSHAWLTSYAPYSKPKYVVTVLLEHGGRNITSGATVAKIYQKMIELGYF
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgcgtttagttgttggatttatactattgttttttatatttttattaagtcgt
gtgtattatttgagtataaaatcaaatgtatattatgaagaacttgccaaacaaaatgcc
ataaaaactgaatttttaccacctgttaggggtcaaattacagatagaaatggaacttta
ttggctattaatgatttgggttttagtatttctattaaaccttatttgagtattaaaaag
tcaaataaaggaattttagataaagaattatctgaacttacaaatttatttcccgattta
aatgctagtaaattagcagaaatttataagagaaatgattcttactataatcaagatttt
attaaagtagtagattttataccctatgatgagattattccgcattattcagagttaaat
cttaataaaacaataaaaatagatcctgttgtaaaaagaaaatatccttttggaaaattg
gcttcgcatattattgggtatgtaggtaaggcaaatttgcaagatgttcaagaaaatgaa
atagcaaaactttctaattatacaggaaaaagtggtatagaacgctattataatgatatt
ttacaaggagaaaaaggaactagggtttataaggttaatgccttaaatcaagaagtagaa
cagctttcttacactcctgctatgtctaatgatatagaacttacgatagatatagagctt
caatcttatttaacttcattgtttgaagggaatgctggagctgctataattatgaatgta
aatgatggatctattttagctgcagggagtttccctgaatatgatcttaatccttttgta
acagggatttcttttaaggattgggatgagctttcaaatagtcttgaccatccttttaca
aataaacttataaatggatattatcctccaggttctgttgtaaaaatgggagtagggctt
tcttttttaaattctaaaaatattagtccatcaactcaatatgtttgcaatggaagcatt
gagcttggaggtaggttttttagatgttggaatcgatcaggccatggacctgtggattta
aaacatgcgataaaatatagttgtgatgtttatttttataatggcagtttgcaagttgga
atcgatcaaataagtgaaactttatctcgcattggctttggagcgaaaacaggggtagat
ttacctagtgaatttgtaggaactttaccaagcaaagaatggaagatgcaaagatataga
caatcttggtttcaaggtgatactttaaatacagctataggtcaaggtaattttcttgca
acacctatgcaaattgctagatatacagctcaaatcgcaaaaggtggagaggttatacct
cattttttaaaaagcatagaaaataataatacaactatagaaaatcaaatggatgaaaat
aaaaaagaaatttttactttatttgaaaagagtcaattgccttatataagagatgcaatg
tatgctgttgctaatgagcaaggaggaacctcttatcgttatttgcataatcttgatgtg
aaagttgcagcaaaaacaggaactgctcaggttgtgggattttcacaaacagataaaaat
agggtcgatgaaaaacaatttgagtattatactagatctcatgcgtggcttacttcttat
gctccttattctaagccaaaatatgtagttaccgttcttttggaacatggtgggagaaat
attacttcaggggcaactgtagctaaaatttatcaaaaaatgattgaacttggatatttt
aaataa

DBGET integrated database retrieval system