KEGG   Campylobacter jejuni subsp. jejuni 00-6200: PJ18_05335Help
Entry
PJ18_05335        CDS       T03792                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cjw  Campylobacter jejuni subsp. jejuni 00-6200
Pathway
cjw00330  Arginine and proline metabolism
cjw01100  Metabolic pathways
cjw01110  Biosynthesis of secondary metabolites
cjw01130  Biosynthesis of antibiotics
cjw01230  Biosynthesis of amino acids
Module
cjw_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cjw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PJ18_05335
Enzymes [BR:cjw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     PJ18_05335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Sacchrp_dh_NADP Phi-29_GP3
Motif
Other DBs
NCBI-ProteinID: AJK72906
UniProt: A0A0B6V703
LinkDB All DBs
Position
1012122..1012853
Genome map
AA seq 243 aa AA seqDB search
MLYILANGSMATALAYGLKDDYEICIVGRSIEKLQALAKEGFKTLLYKDFNIEGKDVILA
FKPYALENIAQMLKGQARILISVLANVDFEKLQTIKAQNYVRIIPNTAAKYKASTTPYIL
KNSHFENEILDILKTFGSAYKLDNEIQMNAAMAISGCAPAFLALIAESIANAGVYEGLSK
ELSLNLTRSLFKSSNALLEHEHPAIIKENICSPGGVTIKGIKILEQKGIRGSFFEAINAS
SAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatacttgcaaatggatctatggcaacagccttagcctatgggttaaaagat
gattatgaaatttgtatagtaggaagaagtatagaaaaacttcaagccctcgccaaagaa
ggctttaaaaccttactttacaaagattttaacatagaaggtaaagatgttattttagca
tttaaaccttatgctttagaaaatattgctcaaatgctaaaaggacaagcacgtatctta
atctctgttttagccaatgttgattttgaaaaactacaaaccatcaaagctcaaaattat
gttagaataatacccaatacagcagctaaatacaaggcttcaaccacaccatatatactt
aaaaactctcattttgaaaatgaaattttagacattttaaaaacttttggctcggcttat
aaattagataatgaaatacaaatgaatgcagctatggcgattagcggctgcgctcctgct
tttttagcacttatagcagaaagcattgctaatgctggagtttatgaaggtttgtcaaaa
gaacttagtctcaatcttacgcgctctttatttaaaagctctaatgctttactagaacat
gaacatccagctattatcaaagaaaatatttgctcccctggcggagttacaataaaaggc
ataaaaatactcgaacaaaaaggaattcgcggaagtttttttgaagccataaatgctagc
agcgctaaatga

DBGET integrated database retrieval system