KEGG   Campylobacter jejuni subsp. jejuni 00-6200: PJ18_06650Help
Entry
PJ18_06650        CDS       T03792                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cjw  Campylobacter jejuni subsp. jejuni 00-6200
Pathway
cjw00061  Fatty acid biosynthesis
cjw00620  Pyruvate metabolism
cjw00640  Propanoate metabolism
cjw01100  Metabolic pathways
cjw01110  Biosynthesis of secondary metabolites
cjw01120  Microbial metabolism in diverse environments
cjw01130  Biosynthesis of antibiotics
cjw01200  Carbon metabolism
cjw01212  Fatty acid metabolism
Module
cjw_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cjw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PJ18_06650
   00640 Propanoate metabolism
    PJ18_06650
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PJ18_06650
Enzymes [BR:cjw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PJ18_06650
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PJ18_06650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 ATP-grasp_5 DUF3182
Motif
Other DBs
NCBI-ProteinID: AJK73162
LinkDB All DBs
Structure
PDB: 

Position
complement(1260424..1261755)
Genome map
AA seq 443 aa AA seqDB search
MEIKSILIANRGEIALRALRTIKEMGKKAICVYSEADKDALYLKYADASICIGKARSSES
YLNIPAIIAAAEIAEADAIFPGYGFLSENQNFVEICAKHNIKFIGPSVEAMNLMSDKSKA
KQVMQRAGVPVIPGSDGALAGAEAAKKLAKEIGYPVILKAAAGGGGRGMRVVENEKDLEK
AYWSAESEAMTAFGDGTMYMEKYIQNPRHIEVQVIGDSFGNVIHVGERDCSMQRRHQKLI
EESPAILLDEKTRTRLHETAIKAAKAIGYEGAGTFEFLVDKNLDFYFIEMNTRLQVEHCV
SEMVSGIDIIEQMIKVAEGYALPSQESIKLNGHSIECRITAEDSKTFLPSPGKITKYIPP
AGRNVRMESHCYQDYSVPAYYDSMIGKLVVWAEDRNKAIAKMKVALDELLISGIKTTKDF
HLSMMENPDFINNNYDTNYLARH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaagcatattaattgctaatcgtggagaaatagcactgcgtgctttaaga
acgattaaagaaatgggtaaaaaagcaatttgtgtgtattctgaagcagataaagatgct
ttgtatttaaaatacgctgatgcaagcatttgtataggtaaggcaagaagttctgaaagt
tatttaaatatcccagctatcatcgcagcggctgaaatagcagaagctgatgcgattttt
ccaggatacggatttttaagtgaaaatcaaaattttgttgaaatttgtgctaaacataac
atcaaatttataggtccttctgtggaagctatgaatttaatgagtgataaatcaaaagca
aaacaagtcatgcaaagagcaggcgtacctgtgatcccaggaagcgatggggctttggca
ggagctgaagcagctaaaaaacttgccaaagaaataggttatcctgtgattttaaaagca
gctgcaggtggtggtggtcgtggtatgcgtgtggttgaaaatgaaaaagatcttgaaaaa
gcgtattggtcggctgaaagcgaggctatgacagcatttggcgatggaactatgtatatg
gaaaaatacatacaaaatccacgccatatagaagtgcaggttataggagatagttttggc
aatgtgattcatgtgggcgaaagagattgttctatgcaaagacgccatcaaaaacttata
gaagaatcccctgcgattttgcttgatgaaaaaacacgcactaggcttcatgaaactgct
attaaggcagctaaagctataggatatgaaggtgcgggaacttttgagtttttagtagat
aaaaatttagacttttattttatagaaatgaatacgcgtttgcaagttgaacactgtgta
agtgaaatggtaagtgggattgatatcatagaacaaatgattaaagtagcagaaggttat
gccttaccatctcaagaaagtattaagcttaatgggcattctatagaatgtagaatcaca
gctgaagattctaaaaccttcttgccaagtccaggtaagattactaaatacattccaccc
gcaggacgcaatgtaagaatggaaagtcattgttatcaagactatagcgtgcctgcttat
tatgattctatgataggcaaacttgtagtttgggcagaagatcgtaataaagctattgca
aagatgaaagtagctttagatgagttgcttataagtgggataaaaacgactaaagatttt
catctttccatgatggaaaatcctgattttattaataataattacgatacaaattatctt
gcaagacattaa

DBGET integrated database retrieval system