KEGG   Campylobacter jejuni 32488: M635_02145Help
Entry
M635_02145        CDS       T02759                                 

Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cjz  Campylobacter jejuni 32488
Pathway
cjz00061  Fatty acid biosynthesis
cjz00620  Pyruvate metabolism
cjz00640  Propanoate metabolism
cjz01100  Metabolic pathways
cjz01110  Biosynthesis of secondary metabolites
cjz01120  Microbial metabolism in diverse environments
cjz01130  Biosynthesis of antibiotics
cjz01200  Carbon metabolism
cjz01212  Fatty acid metabolism
Module
cjz_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cjz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M635_02145
   00640 Propanoate metabolism
    M635_02145
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M635_02145
Enzymes [BR:cjz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     M635_02145
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     M635_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 ATP-grasp_5 DUF3182
Motif
Other DBs
NCBI-ProteinID: AGQ94495
LinkDB All DBs
Structure
PDB: 

Position
complement(407346..408677)
Genome map
AA seq 443 aa AA seqDB search
MEIKSILIANRGEIALRALRTIKEMGKKAICVYSEADKDALYLKYADASICIGKARSSES
YLNIPAIITAAEIAEADAIFPGYGFLSENQNFVEICAKHNIKFIGPSVEAMNLMSDKSKA
KQVMQRAGVPVIPGSDGALAGAEAAKKLAKEIGYPVILKAAAGGGGRGMRVVENEKDLEK
AYWSAESEAMTAFGDGTMYMEKYIQNPRHIEVQVIGDSFGNVIHVGERDCSMQRRHQKLI
EESPAILLDEKTRTRLHETAVKAAKAIGYEGAGTFEFLVDKNLDFYFIEMNTRLQVEHCV
SEMVSGIDIIEQMIKVAEGYALPSQESIKLNGHSIECRITAEDSKTFLPSPGKITKYIPP
AGRNVRMESHCYQDYSVPPYYDSMIGKLVVWAEDRNKAIAKMKVALDELLISGIKTTKDF
HLSMMENPDFINNNYDTNYLARH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaagcatattaattgctaatcgtggagaaatagcactgcgtgctttaaga
acgattaaagaaatgggtaaaaaagcaatttgtgtgtactctgaagcagataaagatgct
ttgtatttaaaatacgctgatgcaagcatttgtataggcaaagcaagaagttctgaaagc
tatttaaatatcccagctattattacagcagctgaaattgctgaagcagatgcgattttt
ccaggatatggatttttaagcgaaaatcaaaattttgttgaaatttgtgctaaacataac
attaaattcataggtccttctgtagaagctatgaatttaatgagtgataaatcaaaagct
aaacaagtaatgcaaagagcaggcgtacctgtaatcccaggaagtgatggagctttagcc
ggagctgaagcagctaaaaaacttgccaaagaaataggctatcctgtgattttaaaagca
gccgcaggtggtggtggtcgtggtatgcgtgtggttgaaaatgaaaaagatcttgaaaaa
gcgtattggtcggctgaaagcgaggctatgacagcatttggtgatggaactatgtatatg
gaaaaatacatacaaaatccacgccatatagaagtgcaggttataggagatagttttggt
aatgtgatccatgtgggcgaaagagattgttctatgcaaagacgccatcaaaaacttata
gaagagtcccctgcaattttacttgatgaaaaaacacgcactaggcttcatgaaactgct
gttaaagcggctaaagctataggctatgaaggtgcgggaacttttgagtttttggtagat
aaaaatttggatttttattttatagaaatgaatacgcgtttgcaagttgaacactgtgta
agtgaaatggtaagtgggattgatatcatagaacaaatgattaaagtagcagaaggttat
gctttaccatctcaagaaagtattaaattaaatgggcattctatagaatgtagaatcaca
gccgaagattccaaaactttcttgccaagtccaggtaagattactaaatacattccacca
gcaggacgcaatgtcagaatggaaagtcattgttatcaagactatagcgtgcctccttat
tatgattctatgataggcaaacttgtagtttgggcagaagatcgtaataaagctattgca
aaaatgaaagtagctttagatgagttgcttataagtgggataaaaacaaccaaagatttt
catctttctatgatggaaaatcctgattttattaataataattacgatacaaattatctt
gcaagacattaa

DBGET integrated database retrieval system