KEGG   Comamonas kerstersii: B5M06_02390Help
Entry
B5M06_02390       CDS       T04758                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cke  Comamonas kerstersii
Pathway
cke00550  Peptidoglycan biosynthesis
cke01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B5M06_02390
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    B5M06_02390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cke01011]
    B5M06_02390
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cke03036]
    B5M06_02390
Enzymes [BR:cke01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     B5M06_02390
Peptidoglycan biosynthesis and degradation proteins [BR:cke01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   B5M06_02390
Chromosome and associated proteins [BR:cke03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    B5M06_02390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AQZ97288
UniProt: A0A0W7YXS7
LinkDB All DBs
Position
complement(516323..518065)
Genome map
AA seq 580 aa AA seqDB search
MRRGLNYTSSPLLASKTPAWRSKFVMACLVLAFTGLAARAAWVQVIDNDFFLRQGEVRFA
RTLELSANRGRILDRNGLILASSVPAASIWAIPEDVEKNTPEDLAKLPQLAKLMDMPLDQ
LKKKLSEDKSFVWVKRQLDWEVGQKIKELGIKGVYQSREYKRQYPEGEAAAHIVGFTNVE
DKGQEGMELAFENDLAGRKGSRRVIKDRLGRVVEGVGEEIPPIDGRDIQLSIDSKIQFFA
YQKLKEQVIAHKAVGGSVVVMDAKTGELLALANYPSFDPANRKRLTGEQLRNRAITDVFE
PGSIMKPITVGIALESGKFRPSSVIDTTPGRINVTGSVISDTRNYGVLTVEGVIQKSSNV
GTTKIAQQLSAQEMWETFSAVGFGQKPQISFPGAASGRLRPHKTWRPVEQATMSYGYGLS
ASLVQMVRAYTVFSNGGKVIPATMLKLDRPPVGVPVFSERTAEQVRKMLALATGPGGTGQ
RAQTVGYSVGGKSGTARKQVGKSYAAGKYRAWFAGMAPIENPRVIVAVMVDEPSNGTYYG
GAVAAPVFSTVVQHSLRLLGVAPDMAVQPQIVADPVEESL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgcggcctgaactacacctccagccccttgctggccagcaagacacctgcatgg
cgtagcaaatttgtcatggcctgtctggtgctggcttttacggggctggccgcacgagcc
gcctgggtgcaggtgatcgacaatgactttttcctgcgtcagggagaggtgcgctttgcg
cgtacgctggagttgtctgccaaccgcggccgcattctggaccgcaatggcctgattctg
gcctccagcgtgccagcggccagcatctgggccattcccgaagatgtggaaaagaacacg
ccggaagatctggccaagctgcctcaactggccaagctgatggacatgccgctcgatcag
ctcaagaaaaagctgtcggaagacaagagctttgtctgggtcaagcgccagctggactgg
gaagtcggtcagaagatcaaggagctggggatcaagggtgtctaccagtcgcgtgagtac
aagcgccagtatcccgaaggtgaagctgccgcccacatcgtaggctttaccaatgtggaa
gacaaaggccaggaaggcatggagctggcttttgagaacgatctggcgggccgcaaaggt
tcacgccgcgtgatcaaggatcgtctggggcgtgtggtcgaaggcgtgggggaagaaatc
ccgcccatcgatggccgtgacattcagctgtcgatcgacagcaagattcagttctttgcc
taccagaagctcaaggagcaggtgattgcgcacaaggccgtaggtggcagtgtggtggtc
atggatgccaagactggtgagttgctggcactggccaactatccgagctttgacccggct
aaccgcaagcgcctgaccggtgagcagctgcgcaaccgtgccattaccgatgtgttcgag
cctggctcgatcatgaaacctattaccgtgggcatcgcactggagagcggcaagttcaga
ccaagttcggtgattgacaccacaccaggtcgcatcaatgtgaccggttctgtcatttcc
gacacgcgcaactatggtgtattgacggtggagggcgtgatccagaagtcttccaacgtg
ggtacgaccaagattgcccagcagctgagtgcccaggaaatgtgggaaaccttctctgcg
gtgggctttggccagaagccgcagatttccttccctggtgctgccagtggccgtctgcgc
ccccacaagacctggcgacctgtggaacaggccaccatgtcctatggctatggactctca
gccagcttggtgcagatggtgcgtgcctataccgtgttctccaatggtggcaaggtgata
cctgccaccatgctcaagctcgacaggcctcctgtgggcgttcccgtgttttcggagcgt
actgccgagcaggtgcgcaagatgctggcgttggcgacaggtccaggtggtacaggccag
cgggcgcaaaccgtgggctattccgtcggtggcaagtcgggtacagcacgcaagcaggtg
ggcaaaagctatgccgcaggaaaataccgcgcttggtttgctggcatggcgccgattgag
aatccgcgcgtaattgtggcggtcatggtcgatgagcctagcaacggcacttattacggt
ggagctgtggcagcccccgtgttcagtaccgtcgtgcagcacagcttacggctgttgggg
gtcgcgcctgacatggcagtgcaaccacaaatcgtggccgaccccgtggaggaatcgctg
tga

DBGET integrated database retrieval system