KEGG   Comamonas kerstersii: B5M06_05585Help
Entry
B5M06_05585       CDS       T04758                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cke  Comamonas kerstersii
Pathway
cke00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B5M06_05585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cke02000]
    B5M06_05585
Enzymes [BR:cke01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     B5M06_05585
Transporters [BR:cke02000]
 Other Transporters
  Pores ion channels [TC:1]
   B5M06_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_2 GST_N_3 GST_N GST_C_6 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: AQZ97814
UniProt: A0A1V0BDC4
LinkDB All DBs
Position
1183171..1183779
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVAEEAGLPCEFILVSTKSHKLQDGTDFYSINPLGYVPFLVLDDG
QTLREGPVIVQYLADQVPEKKLLPAVGSMERYRVLEWLNFIGTELHKSFGPLFKPGTPED
YKPAVREALRGRFEWVEQQLAGKDYLMGEQFTVADAYLFTVSGWGKFVGLDLSDLPHLQA
YLARVGSRPAVQAALRAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattacagccccggagcctgttcgctgtcgccccatatcgtggccgaagaa
gctggcctgccctgtgagttcatcttggtcagtaccaagagccacaagctgcaggacggc
accgacttctacagcatcaatccgctgggctatgtgcctttcctggtgctggacgatggc
cagacactgcgcgaaggccccgtgatcgtgcagtacctggcagaccaggtacctgagaaa
aagctgctgcccgccgtcggcagcatggaacgctaccgcgtgctggaatggctgaacttc
atcggcaccgagctgcacaagagctttggccccctgttcaagcccggcacacccgaggac
tacaagcctgccgtgcgcgaagcgctgcgcggccgctttgagtgggtggagcagcagctc
gcaggcaaggactacctgatgggcgagcagttcaccgtggccgatgcctacctgttcacc
gtcagcggctggggcaagtttgtaggcctggatctgagcgatctgccccacctgcaagcc
tatctggcacgcgtaggcagccgccctgccgtgcaggccgcgctgcgtgctgaaggtctg
ctcaagtaa

DBGET integrated database retrieval system