KEGG   Comamonas kerstersii: B5M06_06945Help
Entry
B5M06_06945       CDS       T04758                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cke  Comamonas kerstersii
Pathway
cke00564  Glycerophospholipid metabolism
cke01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B5M06_06945
Enzymes [BR:cke01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B5M06_06945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 HI0933_like Pyr_redox_2 GIDA Trp_halogenase Lycopene_cycl Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AQZ98027
UniProt: A0A1V0BDN3
LinkDB All DBs
Position
1491806..1493407
Genome map
AA seq 533 aa AA seqDB search
MTIASTPLTTDRAELLARLAQPETYDLLIIGGGATGLGTAVDAVARGFKVCLLESHDFAK
GTSSRATKLVHGGVRYLAQGNISLVREALHERTTLLNNAPHLAQPLPFVMPSYRLLDTPF
YGAGLKMYDALAGKDGLGRTEFLSKDKTLRLLPTVRTDHLKGGVKYWDGQFDDARLALAL
ARTAAAKGALLVNYCPAKELLHTDGKVSGVVCEDAETGTRYEVHAKCVVNATGPWVDLFR
QQDAEMLGKPVKPMVAPSQGVHVVVDREFLPTDHALLVPKTADGRVLFAVPWLGKVILGT
TDTPRHDLAREPEAFEQEIEFILKEAGNYLCRRPTRADVRSIWVGMRPLVKPQDDDGENT
KKISREHTVMTSKSGLVTVTGGKWTTYRAMAEDVLKECFEQKLLPARAGGVTVKMPLVGA
PQPAQVKHRMNAAQGEHIYGTEAEAVRVLKGADQWLVDGLSEAMVRFAARYEYARTVEDV
LARRCRLLFLDARQAAAVAPRVADILAQELPGADVKLADFLALAQQYTLSPKK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgcttctacgcccctgaccactgaccgtgccgagctgctggcacgcttggct
cagccagaaacctacgatttgctgattattggcggcggtgccaccggtctgggtactgca
gtagatgccgtggcgcgaggcttcaaggtctgtctgctggagtcgcacgactttgccaag
ggtacatcctcgcgtgccaccaaactggtgcatggcggcgtgcgctatctggcacagggc
aatatctcgctggtgcgcgaagcgctgcacgagcgcaccacgctgctgaacaatgcgccc
cacctggcgcaacctctgccattcgttatgccctcgtacaggctgctggacacgcccttc
tacggcgccggtctgaagatgtatgacgcgctggcaggcaaggatgggttgggacgcacc
gaatttctgagcaaggacaagaccctgcgcctgctgcccaccgtgcgtaccgaccacctc
aagggtggcgtgaagtactgggacggtcagttcgacgatgcacgcctggcgctggcgctg
gcccgtacggccgccgccaagggcgctctgctggtgaactactgccccgccaaggagttg
ctgcacacggatggcaaggtgtcgggcgtggtctgtgaagacgcagaaaccggcactcgc
tacgaagtgcatgccaagtgtgtggtcaacgcaacaggcccctgggtggacctgttccgt
cagcaggacgccgaaatgctgggcaagcccgtcaagcccatggtcgcgcccagccagggc
gtgcacgtggtggtggaccgcgaattcctgccgaccgaccacgccctgctggtgcccaag
accgccgatggccgcgtgctgtttgccgtgccatggctgggcaaggtcattctgggcacg
accgacaccccccgccacgacctggcgcgtgagcccgaagccttcgagcaggaaatcgaa
ttcatcctcaaggaagcaggtaactacctgtgccgccgtccgacccgcgccgatgtgcgc
agcatctgggtgggtatgcgtccgctggtcaagccacaggacgatgatggcgagaacacc
aagaagatcagccgcgagcacacggtgatgaccagcaagtccggcctcgtcaccgtgacc
ggcggcaagtggaccacctaccgcgccatggccgaagacgtgctcaaggaatgctttgag
caaaagctcctgcccgcacgtgccggtggcgttaccgtcaagatgccgctggtgggtgca
ccccagccagcgcaggtcaagcaccgcatgaatgcggcccagggtgagcacatctacggc
acagaggccgaagccgtgcgcgtactcaagggtgcagaccagtggctggtcgatggtctg
tcagaggccatggtccgctttgcggcgcgctacgaatacgcccgcaccgtggaagacgtg
ctggcccgccgctgccgcctgctgttcctcgatgcgcgccaggccgctgccgtagcgccg
cgcgtggccgacattctggctcaggagctgcccggtgctgatgtcaagctggcggacttt
ttggccctggcacaacaatacaccctgtcgcccaagaagtaa

DBGET integrated database retrieval system