KEGG   Comamonas kerstersii: B5M06_09975Help
Entry
B5M06_09975       CDS       T04758                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cke  Comamonas kerstersii
Brite
KEGG Orthology (KO) [BR:cke00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B5M06_09975
Enzymes [BR:cke01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B5M06_09975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored Thioredoxin_3 FAD_binding_2 GIDA HI0933_like DAO Glutaredoxin NAD_binding_8 FAD_binding_3 DSBA AlaDh_PNT_C Thioredoxin_4 Thi4 zf-ribbon_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AQZ98527
UniProt: A0A0W7YW00
LinkDB All DBs
Position
2134695..2136251
Genome map
AA seq 518 aa AA seqDB search
MLDANLKTQLKAYLEKLQKPLELVATLDDSKAAGEVKSLLADLAALSDKITVVENNDLNV
RKPSFAINNPGVETGVRFAGVPLGHEFTSLVLALLHVGGHPSKESADLLEQVKAIDTPLH
FETYYSLSCHNCPDVVQALNLMSALNPNITHTAIDGGLFQQEVKDREVMGVPTVFVNGER
FGQGRMELAEIVAKVDTGAAAREAAKISAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERLGGQVLDTVDIENFISVSKTEGPKLAAAMAAHIRDYDVDVMNQQKAAKLVPATTEG
GLIEVHTESGAVLKSKTVILSTGARWRHMNVPGEEQYLTKGVTFCPHCDGPLFKGKPVAV
IGGGNSGVEAAIDLAGLVKHVTLFEFADTLKADAVLQKKLHSLPNVTVITNAQTTEVNGD
GKKVTGITYKDRVTEEVKTVELEGIFVQIGLLPNTDWLKGTVNLSRFGEIEINAKGETNV
PGVFAAGDCTNVPYKQIVIATGAGATAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctcaaaacccaactcaaggcttacctcgaaaagctgcaaaagccc
ctggaactggtggcaactttggacgacagcaaggcggctggcgaagtcaagtctttgctg
gcggatctggccgcgctgagcgacaagatcactgtcgttgagaacaacgatctgaacgtg
cgcaagccctcgttcgccatcaacaaccccggtgtggaaactggcgtgcgctttgccggt
gtgcccctgggtcacgaattcacctccctcgtgctggcgctgctgcacgtaggtggccat
ccctccaaggagtcggctgatctgctcgaacaagtcaaggccattgacacgcctttgcac
ttcgagacctactactccctgtcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcggccctgaaccccaacatcacccacactgccattgacggcggcctgttccag
caggaagtcaaagaccgcgaagtcatgggcgtacccaccgtgtttgtgaacggcgaacgc
tttggtcagggccgtatggagctggccgagatcgtcgccaaggtcgacaccggcgctgcg
gcccgtgaagctgccaagatctctgccaaggacgcgtttgacgtgctggttgtcggcggt
ggccctgctggcgcggctgcagccatctacgctgctcgcaagggcatccgcaccggtatt
gctgccgagcgtctgggcggccaggtgctggataccgtggacatcgagaacttcatctcg
gtctccaagaccgaaggccccaagctggctgctgccatggctgctcacatccgtgactac
gacgtggacgtgatgaaccagcaaaaggctgccaagctggtgcccgccaccaccgaaggt
ggcctgattgaagtgcacaccgaatccggtgcagtgctcaagtccaagaccgtgatcctg
tccaccggcgcccgctggcgccacatgaacgtgcccggcgaagagcagtacctgaccaag
ggcgtgactttctgcccccactgcgacggccctctgttcaagggcaagcccgtggccgtg
atcggtggcggtaactccggcgtggaagctgccatcgacctggccggtctcgtcaagcac
gtcaccctgttcgagtttgccgacaccctgaaggccgacgccgtgctgcagaagaaactg
cacagcctgcccaatgtgaccgtgatcaccaacgcccagaccacggaagtcaatggcgac
ggcaagaaggtcactggcatcacctacaaggaccgcgtgaccgaagaggtcaagaccgtg
gaactggaaggcatctttgtacagattggcctgctgcccaacaccgactggctcaagggc
accgtcaacctgagccgctttggcgagatcgaaatcaatgccaagggcgaaaccaatgtg
cccggcgtgtttgccgcgggtgactgcaccaatgtgccttacaagcagattgtgattgcc
accggcgcaggtgctacagctgccctgtcggcctttgaccacctgattcgccattga

DBGET integrated database retrieval system