KEGG   Comamonas kerstersii: B5M06_10900Help
Entry
B5M06_10900       CDS       T04758                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cke  Comamonas kerstersii
Pathway
cke00020  Citrate cycle (TCA cycle)
cke00190  Oxidative phosphorylation
cke00650  Butanoate metabolism
cke01100  Metabolic pathways
cke01110  Biosynthesis of secondary metabolites
cke01120  Microbial metabolism in diverse environments
cke01130  Biosynthesis of antibiotics
cke01200  Carbon metabolism
Module
cke_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cke_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cke_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5M06_10900 (sdhB)
   00650 Butanoate metabolism
    B5M06_10900 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B5M06_10900 (sdhB)
Enzymes [BR:cke01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B5M06_10900 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     B5M06_10900 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_16 Fer4_7 Fer4_18 Fer2 Fer4 Fer4_4 Fer4_20
Motif
Other DBs
NCBI-ProteinID: AQZ98680
UniProt: A0A0W7Z0Z5
LinkDB All DBs
Position
complement(2338040..2338744)
Genome map
AA seq 234 aa AA seqDB search
MKRTFKIYRYDPDKDAKPYMQTVEVELDGHERMLLDALVKLKAQDPSISFRRSCREGVCG
SDAMNINGKNGLACLTNMNTLKGDIVLKPLPGLPVIRDLIVDMTQFFKQYHSIKPYLQSD
IYATPSKERLQSPEEREELNGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDTATGERLDNLQDPYRLFRCHTIMNCVDVCPKHLNPTKAIGKIKELMVRRAV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtacttttaagatttaccgctacgaccccgataaggacgccaagccttacatg
cagactgtggaggtcgaactcgacggccacgagcgcatgctgctggatgccctggtcaag
ctcaaggcccaggatccctcgatctccttccgtcgctcctgccgcgaaggtgtgtgtggt
tctgacgccatgaacatcaatggcaagaacggtctggcctgcctgacgaacatgaacacc
ctcaagggcgacatcgttctcaagcccctgcccggtctgccagtgatccgcgacctgatc
gtggacatgacccagttcttcaagcagtaccactcgatcaagccttacctgcaaagcgac
atctacgcaacgcccagcaaggagcgtctgcagtcgcccgaagagcgtgaagagctcaac
ggcctgtacgagtgcattctgtgcgccagctgctcgaccagctgcccctcgttctggtgg
aaccccgacaagttcgtgggccccgctggcctgctgcaggcataccgcttcatcgcggac
agccgcgacacagcgaccggcgagcgtctggacaacctgcaggacccttaccgcctgttc
cgttgccacaccatcatgaactgtgtggacgtgtgccccaagcacctgaaccccaccaag
gccatcggcaagatcaaggaattgatggtgcgccgcgccgtctaa

DBGET integrated database retrieval system