KEGG   Comamonas kerstersii: B5M06_10905Help
Entry
B5M06_10905       CDS       T04758                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cke  Comamonas kerstersii
Pathway
cke00020  Citrate cycle (TCA cycle)
cke00190  Oxidative phosphorylation
cke00650  Butanoate metabolism
cke01100  Metabolic pathways
cke01110  Biosynthesis of secondary metabolites
cke01120  Microbial metabolism in diverse environments
cke01130  Biosynthesis of antibiotics
cke01200  Carbon metabolism
Module
cke_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cke_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cke_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5M06_10905
   00650 Butanoate metabolism
    B5M06_10905
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B5M06_10905
Enzymes [BR:cke01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B5M06_10905
    1.3.5.4  fumarate reductase (quinol)
     B5M06_10905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA HI0933_like Lycopene_cycl Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AQZ98681
UniProt: A0A0W7Z0W7
LinkDB All DBs
Position
complement(2338775..2340580)
Genome map
AA seq 601 aa AA seqDB search
MSYTKANITKRKFDVVIVGAGGSGLRAALELSRAGLSVASLSKVFPTRSHTVAAQGGVSA
SLGNMNEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNVVIELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQQNVKSKTNFFVEWMALDLIRNTQG
DVVGVTALELETGDLYELHAKAVLLATGGAGRIFQASTNAFINTGDGLGMAARAGIPLQD
MEFWQFHPTGVAGAGVLLTEGCRGEGAILLNSEGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDYILMKLDHLGAETIRKRLPSVEEIGHNFANVDITKEPIPVVPTIHYM
MGGIPTNIHGQVVTWNGTQNTTVNGLYAVGECSCVSVHGANRLGTNSLLDLLVFGKSAGK
HIVEFVKGFGDHHQVPADASDRTLERLNALDNSKEGIYAQDVANEIRQSMQQHAGVFRTQ
KGMDEGVVKINAIREKVGAVGLKDKSKVWNTARMEALEVDNLIEVAQATMTSAAARHECR
GAHTVYDYEHPADHAEFPLGRNDKEWLKHTLWDSASNSLTYKPVNLKPLTVESVPPKVRT
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagctacacaaaagcaaacatcaccaagcgcaagtttgacgttgtcatcgtcggcgct
ggcggctccggtctgcgtgccgcactggaactttcccgcgctggtctgagcgtggcttcg
ctgtccaaggtgttccccacacgttcgcacactgtggctgcacagggtggcgtgtccgca
tcgctgggcaacatgaacgaagacaactggcactaccacttctacgacaccatcaagggt
tcggactggctgggcgaccaggatgccatcgagttcatgtgccgcgaagcacccaacgtg
gtgatcgagctggaacacttcggcatgccgttcgaccgcaaccccgacggcaccatctac
cagcgtcccttcggcggccacactgccaactacggtgaaaagcctgtgcagcgcgcctgc
gctgctgctgaccgtactggccacgccatgctgcacaccctgtaccagcagaacgtcaag
tccaagaccaacttcttcgtggagtggatggcgctggacctgatccgcaacacccagggt
gacgtagtgggcgtgactgcactggagctggaaaccggtgacctgtacgaactgcacgcc
aaggctgtgctgctggctaccggcggtgcaggccgtatcttccaggcatcgaccaatgcc
ttcatcaacaccggtgacggcctgggcatggcagcgcgtgctggcattcctctgcaggac
atggagttctggcagttccaccccaccggcgtggctggtgctggcgtgctgctgaccgaa
ggctgccgcggcgaaggcgcaattttgctcaacagcgaaggcgagcgcttcatggagcgc
tacgctcctaccctgaaggacctggcaccccgtgacttcgtgtcgcgctccatggaccag
gaaatcaaggaaggtcgtggctgcggtcctaacaaggactacatcctgatgaagctggac
cacctgggtgccgaaaccatccgcaagcgtctgccttccgtggaagagatcggccacaac
ttcgccaacgtggacatcaccaaggagcccatccctgtggtgcctaccatccactacatg
atgggtggtatccccaccaacatccatggtcaagtggtgacttggaacggcacacagaac
accaccgtcaacggtctgtacgccgtgggcgagtgctcctgcgtgtccgtgcacggcgcc
aaccgcctgggcaccaactccctgctggacctgctggtgttcggcaagtctgctggcaag
cacattgtggaattcgtcaaaggctttggcgaccaccaccaggtgccagccgatgcatcc
gatcgcacgctggagcgcctcaacgcactggacaattccaaggaaggcatctacgcccag
gacgtggccaacgaaatccgtcagtccatgcagcagcacgctggcgtcttccgtacccag
aagggcatggacgaaggtgtggtcaagatcaacgccatccgcgaaaaggtcggcgctgtg
ggcctgaaggacaagtccaaggtctggaacaccgcccgtatggaagccctggaagtggac
aacctgatcgaagttgctcaggccaccatgacctccgctgccgctcgccacgaatgccgc
ggtgcacacaccgtgtacgactacgagcatcctgctgaccacgcggaattcccgctgggc
cgcaacgacaaggaatggctgaagcacaccctgtgggacagcgcatccaacagcctgacc
tacaagcctgtgaacctcaagcccctgaccgtggaatccgtgccacccaaggtccgtacg
ttctaa

DBGET integrated database retrieval system