KEGG   Comamonas kerstersii: B5M06_12360Help
Entry
B5M06_12360       CDS       T04758                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cke  Comamonas kerstersii
Pathway
cke00020  Citrate cycle (TCA cycle)
cke00480  Glutathione metabolism
cke01100  Metabolic pathways
cke01110  Biosynthesis of secondary metabolites
cke01120  Microbial metabolism in diverse environments
cke01130  Biosynthesis of antibiotics
cke01200  Carbon metabolism
cke01210  2-Oxocarboxylic acid metabolism
cke01230  Biosynthesis of amino acids
Module
cke_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cke_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cke00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5M06_12360
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B5M06_12360
Enzymes [BR:cke01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B5M06_12360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH CAMP_factor
Motif
Other DBs
NCBI-ProteinID: AQZ98925
UniProt: A0A1V0BG79
LinkDB All DBs
Position
2627485..2629722
Genome map
AA seq 745 aa AA seqDB search
MTTQQSTIIYTLTDEAPRLATSAFLPVVQAFASTAGVNVETSDISVAARILGEFPDYLTE
EQRVPNSLSELGKKTLEPDANIIKLPNISASVAQLTAAIKELQAKGYNVPDYPDQPTNEQ
EKEIKARYSKCLGSAVNPVLREGNSDRRAPAAVKNYARKHPHSMGEWKPWSQTHVSHMHE
GDFYHGEKSLTLDKARNVKMVLETKSGKTIVLKEKVALLDGEIIDSMFMSKKALCDFYEK
ELEDCKEAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMA
TLYEKIETLPASKREEIIRDLHACQEHRPALAMVDSAKGITNFHSPNDVIVDASMPAMIR
AGGKMWGADGKQYDCKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEISEDGVANIVDIETGEVLLSQNVEAGDIWRMCQVKDAAIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVEKYLKDHDTTGLDIQIMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
FLRWDSLGEFLALAVSLEDLGIKENNARAKLLAKTLDQATGRLLDENKSPSRKVGQIDNR
GSQFYLTLFWAQALAEQTEDAELAAKFTSIAKYLAENEAKIVQELLAVQGKPADIGGYYL
PELSKLDAVMRPSTTFNKVVELLKA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcagcaatccaccatcatctacaccctgacggatgaagctccccgtctggcc
accagtgcattcttgcccgttgtgcaagcttttgcttccaccgctggcgtgaatgtcgaa
accagcgacatctcggtcgctgcgcgcattctgggtgaattcccagactatctgacggaa
gagcagcgcgtgcccaactcgctgtccgaactgggcaagaagacgctggagcctgatgcc
aacatcatcaagctgcccaacatctcggcgtccgtggcccagctgactgctgccatcaag
gaattgcaggccaagggctacaacgtgcccgactatcctgaccagcccaccaacgagcag
gaaaaggaaatcaaggctcgctactccaagtgcctgggctcggctgtgaaccccgtgctg
cgcgaaggtaactctgaccgccgcgcgcctgccgcggtgaagaactatgcccgcaagcat
ccccactccatgggtgagtggaaaccatggtcgcagacccacgtgtcccacatgcacgaa
ggcgacttctatcacggcgaaaagtcgctgacgctggacaaggcgcgcaacgtgaagatg
gtgctggagaccaagtctggcaagaccatcgtgctcaaggagaaggtggcgctgctggat
ggcgagatcatcgactccatgttcatgagcaagaaggcgctgtgcgacttctacgaaaag
gaactggaagactgcaaggaagctggcatcctgttctcactgcacgtgaaggccaccatg
atgaaggtttcgcaccccatcgtgttcggtcactgcgtgaagatctactacaaggaagct
ttcgagaagcacggcaagctgtttgacgagctgggcatcaacgtcaacaacggcatggct
acgctctacgaaaagatcgagaccctgcctgcttccaagcgcgaagaaatcatccgcgac
ctgcacgcctgccaggaacaccgtcctgcgctggccatggtggactctgccaagggcatc
accaacttccactcgcccaacgacgtgattgtggacgcttccatgcctgccatgattcgc
gctggcggcaagatgtggggcgctgacggcaagcagtacgactgcaaggccgtgatgcct
gagtcgacctttgcccgtatttatcaggagatgatcaacttctgcaagtggcacggcaac
ttcgaccccaagaccatgggcaccgtgcctaacgtgggcctgatggcacaaaaggctgag
gaatatggctcgcacgacaagactttcgaaatctccgaagacggcgtggccaacatcgtg
gacatcgaaaccggtgaagtgctgctgtcccagaacgtggaagctggcgacatctggcgc
atgtgccaggtcaaggacgcagccatccgtgactgggtgaagctggccgtgacccgtgcc
cgcaactccggcatgcctgctgtgttctggctggatccctatcgtccccacgaagcagag
ctgatcaagaaggtggaaaagtacctgaaggatcacgacaccaccggtctggacatccag
atcatgagccaggtgcgcgccatgcgctacaccctggagcgcgtggtgcgcggtctggac
accatctccgtgaccggcaacatcctgcgcgactacctgaccgacctgttccccatcatg
gaactgggtacatcggccaagatgctgtccatcgtgcctctgatggctggcggcggcatg
tacgaaaccggtgcaggcggctctgcgcccaagcacgtgcagcagctggtggaagaaaac
ttcctgcgctgggactcgctgggtgaattcctggcgctggccgtgtcgctggaagacctg
ggcatcaaggaaaacaatgcccgcgccaagctgctggccaagaccctggaccaggctacc
ggccgtctgctggacgaaaacaagtcgccttcgcgcaaggtgggtcagatcgacaaccgt
ggctcgcagttctacctgaccctgttctgggcacaggcgctggccgagcagaccgaagac
gcggaactggctgccaagttcacctccattgccaagtacctggcagagaacgaagccaag
atcgtgcaggagctgctggctgtgcagggcaagccagccgacatcggtggctactacctg
cctgagctgtccaagctggacgctgtgatgcgccccagcaccaccttcaacaaagtggtg
gagttgctgaaggcctga

DBGET integrated database retrieval system