KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1246Help
Entry
Calkr_1246        CDS       T01356                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00010  Glycolysis / Gluconeogenesis
cki00030  Pentose phosphate pathway
cki00051  Fructose and mannose metabolism
cki00052  Galactose metabolism
cki00680  Methane metabolism
cki01100  Metabolic pathways
cki01110  Biosynthesis of secondary metabolites
cki01120  Microbial metabolism in diverse environments
cki01130  Biosynthesis of antibiotics
cki01200  Carbon metabolism
cki01230  Biosynthesis of amino acids
cki03018  RNA degradation
Module
cki_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkr_1246
   00030 Pentose phosphate pathway
    Calkr_1246
   00051 Fructose and mannose metabolism
    Calkr_1246
   00052 Galactose metabolism
    Calkr_1246
  09102 Energy metabolism
   00680 Methane metabolism
    Calkr_1246
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Calkr_1246
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cki01009]
    Calkr_1246
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cki03019]
    Calkr_1246
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calkr_1246
Protein phosphatases and associated proteins [BR:cki01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calkr_1246
Messenger RNA biogenesis [BR:cki03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Calkr_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADQ40754
UniProt: E4S790
LinkDB All DBs
Position
1301204..1302172
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKTIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggagacgcaccaggaatgaac
gctgctatacgagctgttgtaagaactggtatatactacgggtttagagtgatgggcata
agacgtggctataatggtcttattgaaggcgacatttttgagatgaacctgaggtctgtt
tcagatataatccaacgtggtggaacaatacttttgactgcaaggtctcctgagttcatg
acagaaaatgggctcaaaaaagctgcttcaatgtgcaaaatctttaagattgatgctctt
gttgtaattggtggagatgggtctttcaggggagcaagagacctgagtaagtttggtata
aatgttgttggaattcctggaaccatcgacaatgacatcgcatgtacagactacactatt
ggttttgatacagcattgaatactgtacaggatgcaattaataagataagagacacggca
acctctcatgaaagagttagcatccttgaagtaatgggacgtcatgctggatatattgct
ctttatagcggtattgcaggcggtgctgagtcaattgtgattcccgaaaaaggtcttgac
aaagatgagataatcagaagaataattgatggcaaaaacaaaggaaagctccataacttg
attatattggctgagggaattggtggagcaacagaacttgcaaaggagattgaagaagca
acaggaatagagacaagggcgacaatacttggatatatccagagaggtggatcgcctact
gcgtatgacagagttgttgcaagtttgatgggagcaaaagctgttgaggttatcaaagaa
ggtaagcagaacaggataattgcgatgaaggatggcaagattgttgattatgatattgac
gaagcactttctatgcaaaagacaattgatgaatacatgtacaacttagctactattctt
tctttataa

DBGET integrated database retrieval system