KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1951Help
Entry
Calkr_1951        CDS       T01356                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00970  Aminoacyl-tRNA biosynthesis
cki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cki00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calkr_1951
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cki03029]
    Calkr_1951
Enzymes [BR:cki01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Calkr_1951
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Calkr_1951
Mitochondrial biogenesis [BR:cki03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calkr_1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ADQ41429
UniProt: E4S4M6
LinkDB All DBs
Position
complement(2016189..2017631)
Genome map
AA seq 480 aa AA seqDB search
MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI
MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQKKRIGIKR
IHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRIFLEKLKAILQYTE
VSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEARRQIEVLESG
GVVVQETRRWDDAKGISLSMRTKEEAHDYRYFPEPDLPPIIVDEEWIEEIRKRIPELPDQ
KKERYIKEYGLPEYDAGVLTSSKAIASFFEECIKYTQNIKAASNWVMGEIMRILNDKGLE
PEEIDNIKIKPNQLASLINLVDNKTISNTIAKQVFEEMFETGKDPEVIVKEKGLVQITDR
NVILEAVKQAIVNNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILKEELEKI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgaggttgtgataggtttagaggtccatgctgagcttgcgacaaaatcaaag
atattttgcagctgtacaacagagtttggcggtgagccaaatacccactgctgtcctatt
tgcactggtatgccaggagttttgccagttttgaacaaaaaggcggttgaatatgccata
atggcaggtcttgcaacaaactgccagatagcaagatatagtaagcaggacagaaaaaat
tatttttatcccgaccttccaaaggcttaccagatttcgcagtatgacttgccgctctgt
tacaatggttatatagacattgaggtaaatggacagaaaaagagaataggaataaagaga
attcacatagaagaggatgccggaaagcttcttcatgaccagtgggaagaaggaagtctt
gttgattttaacaggtgcggtgttcctttgattgagattgttacagagccggatttgcgt
tcaagtgaagagacacgaattttccttgaaaagttaaaagcgattttgcaatacactgag
gtttctgactgcaagatgcaggaaggttcgctcagggtggatgtaaacctgtctgtgcgc
ccaaaaggttcaaaagaatttggtacaagaacagaaatgaaaaacttaaactctttcagg
tctgttgtgagggcaatagaatatgaggcaagaaggcaaatagaggttttagaaagcggt
ggtgttgttgttcaggagacaaggcgctgggatgatgcaaaaggcataagtttatctatg
aggacaaaagaagaagcgcatgactacaggtatttcccagagcctgaccttccacctata
attgtagacgaagagtggattgaggagattaggaaaagaattcctgagcttcctgaccag
aaaaaggaaaggtatataaaagagtatgggcttccagaatatgatgccggtgttctgact
tcatcaaaggctatagcaagcttttttgaagagtgtataaaatatacgcaaaacataaag
gctgcaagcaactgggtgatgggagagattatgagaatcttaaatgacaaagggttagaa
cctgaggaaattgacaatataaagattaagccaaaccagcttgcaagccttattaacctt
gttgataacaagacaatttcaaacaccattgcaaaacaagtctttgaagagatgtttgaa
acaggcaaagacccagaggttattgtaaaagaaaaagggcttgttcagataacagacagg
aacgtaattttagaggctgtcaaacaggcaatagtaaacaatccaaaatcagtagaagat
tataaaaatggtaaagacaaggcatttggatttttggtgggccaagttatgaagataaca
aaaggcaaggcaaacccacagcttgtaaatgaaatcttaaaagaagagcttgagaaaatc
taa

DBGET integrated database retrieval system