KEGG   Clostridium kluyveri DSM 555: CKL_0362Help
Entry
CKL_0362          CDS       T00564                                 

Gene name
ahpF
Definition
(GenBank) AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ckl  Clostridium kluyveri DSM 555
Brite
KEGG Orthology (KO) [BR:ckl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKL_0362 (ahpF)
Enzymes [BR:ckl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CKL_0362 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored FAD_binding_2 FAD_binding_3 AlaDh_PNT_C DAO NAD_binding_8 Thi4 Dip Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: EDK32416
UniProt: A5N535
LinkDB All DBs
Position
complement(329328..330857)
Genome map
AA seq 509 aa AA seqDB search
MILDADIKSQLAQYLNLMEGDILLKVSAGSDNTSNDMLTLINEIAGMSSKIKVEKVTLQR
TPSFSINRPHEDTGVIFAGVPLGQEFTSLVLALLQTSGRAPKVDSEILEQITNVKGNYNF
ETYASLSCHNCPDVVQALNLMSILNPNITHTMIDGAVFKKEVEDKNIMAVPSVYLNGNHF
NSGRMTLTDILSKIGSSTKPSEIFNKTPYDVLVVGAGPAGATAAIYAARKGIRTGIIAER
LGGQVTDTVGIENFTGTKYIEGPKLSANLEEHIKEYNVDIITSQYAIGLKKKELIEIQLK
NGTLLKSKTVILSTGASWRNVGVPGEKELKNKGVTYCPHCDGPLFKGKNTAVIGGGNSGI
EAAIDLGGIVNHVTVLEFMPELKADDVLQKRLNSLSNVTVIKNVKIKEITGIDKVNGITY
ADRLTGEKHHIELQGVFVQIGLIPNTDWLDKTITRNSRGEIVVDSHGATDIPGVFASGDC
TNSPYKQIIISMGSGATAALSAFDYLIRS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgattctggatgcagatataaaatcacaattagcccaatatcttaacctgatggaaggc
gatatactgcttaaagttagtgctggatcggataatacatctaatgacatgctgactctt
ataaatgagatagccggtatgtcatctaaaatcaaggtggaaaaagtgacacttcagagg
actccaagttttagtattaaccgtccccatgaagatactggtgtaatttttgcaggtgta
cctttaggtcaagaatttacctcattagtactagcacttctacaaaccagtggaagagcc
ccaaaagttgatagtgaaatacttgaacagattacaaatgtcaaaggtaactataatttt
gaaacttacgccagcttgagctgccacaattgtcctgatgttgtacaggcacttaacctt
atgagtatcctaaatcccaatatcacccatactatgattgatggtgcagtttttaaaaaa
gaagtggaagacaaaaacatcatggcagtaccttctgtctatctgaatggtaatcacttt
aacagcggtcgtatgacacttacagatattctttccaaaattggcagcagtaccaaacca
tcagaaattttcaacaaaaccccttatgatgttctcgttgtaggagccggtccagctggt
gcaactgcagcaatatatgcagcacgaaaaggcatccgcacaggaatcattgctgaacgc
ttgggtggccaggttacggataccgttggtattgaaaattttacaggcacaaaatacatt
gaaggtcctaaactatccgcaaatcttgaagaacacattaaagaatataatgtagatata
attacttcccagtatgccataggtttaaaaaagaaagaattaatagaaattcagctgaaa
aatggaaccttgctaaaaagcaaaactgtaattctttcaacaggcgccagctggcggaat
gttggtgtacctggtgaaaaagagttaaaaaacaaaggtgttacttactgtcctcattgt
gatggtcctttatttaaaggaaagaatacagcagttattggcggcggtaattccggcatt
gaggcggccattgatctgggaggaattgttaatcatgtaactgtccttgagttcatgcca
gaacttaaagctgacgatgtgcttcaaaagcgccttaacagtttgtctaatgtaaccgtc
ataaaaaatgttaaaataaaggaaatcaccggcatagacaaagtaaatggcattacttat
gctgatcgccttacaggagaaaaacatcatattgaactacagggtgtatttgttcagatt
ggtctcatcccaaatactgactggctggacaaaactataacacgcaattcacgaggtgaa
attgttgtggatagccatggtgcaacggacatacctggagtatttgcttcaggagattgc
acaaatagtccatacaaacaaatcattatttccatgggctcaggtgcaactgcagcttta
agtgcatttgattacctaatccgaagttaa

DBGET integrated database retrieval system