KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1649Help
Entry
Calkro_1649       CDS       T01357                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Brite
KEGG Orthology (KO) [BR:ckn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ckn01001]
    Calkro_1649
Enzymes [BR:ckn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Calkro_1649
Protein kinases [BR:ckn01001]
 Serine/threonine kinases: Other
  Bacterial family
   Calkro_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Haspin_kinase Seadorna_VP7 RIO1 FTA2 Kdo Pkinase_fungal ETRAMP
Motif
Other DBs
NCBI-ProteinID: ADQ46501
UniProt: E4SFH6
LinkDB All DBs
Position
complement(1815666..1817549)
Genome map
AA seq 627 aa AA seqDB search
MDEFIIGNRYKVEEKLGSGGMSVVYKAKDAILNRYVAIKVLRSEFATDEEFLQRFRTEAL
AAASLSHPNIVSIYDVGEQDGMYYIVMEYVNGKTLKEFMKETGRLSPKDATTIAIQVLRA
LDHAHKKGIVHRDIKPQNILIDENGIVKVTDFGIARAVSTGTIINTNLTIGSVHYFSPEQ
ARGGYIDNRSDLYSLGVVLYEMVTGVLPFDGDTPISIALKHLQEQPIKPTLYNPNIPKSL
EAIILKAMQKDILLRYQSASEMIQDLKNSLIEPEGDFVKIESHENAATKQFQLEKIKSDN
TSVDQKKESKEKRKDWIYVVAGILTALIIVAIGWLIFYNAIGKSLTYQENDITMPDLVGF
SIDDAKAKLDELGLKYSVEEQNDPAEKGMVINQDPAAGIKVKKDTTVKLIVSKGPEMVKV
PDVVGLNIKDAQIELDNNGLSVEIKKDYSDKPVDTVIDQQPSANQLIEKNGTVILTVSLG
PKIEKVLVPDVTGMNIVDAKDVLLKNGLNAGNVTYKEVTDRESDIVISQSPSYGQQVVKG
STVDLIVTKKVETKTTTKIIIKTVILPSDLNEANVKIVVSSNGNESIVFDRIVKKEETPL
QVKIPITGQSTIRMYINDQLSTEETVE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtttataataggaaacagatacaaagttgaagagaaattaggaagcggtgga
atgtcggttgtgtataaagccaaagacgcaattttgaatagatatgttgccataaaagtt
ttaaggtcggagtttgcaacagacgaggaatttttgcaacggttcagaacagaagcgctg
gcagcagcatctctttcgcatcctaacattgtatctatctatgatgttggtgagcaggac
gggatgtactacatagttatggaatatgtaaatggcaaaactctaaaagagtttatgaaa
gaaactggcaggctcagtccaaaagatgcaacaaccattgctatacaggttttaagagct
ttggaccatgcccataaaaaaggtattgtgcacagggatataaaacctcaaaatatcttg
attgatgaaaatgggattgtcaaagtaacagactttggtattgcacgagcagtttcaaca
ggcactattataaatacaaatctcaccattggctctgttcactatttttctccagaacag
gcaagaggaggatatatagacaataggtcggacttgtattctcttggagttgtactttat
gagatggtaactggagttttgccgtttgatggggatactccaatttctattgctttaaaa
cacctgcaagaacagccaataaaacctacactttataatcccaatataccaaaaagttta
gaagcaataattttgaaggcaatgcaaaaggatattttgctgaggtatcaatcagccagt
gagatgattcaagatttgaaaaattcgctcattgaaccagagggtgattttgtcaagata
gagtcgcatgaaaatgctgctaccaaacagtttcagcttgaaaagataaaatcggataat
acctcagtagaccaaaaaaaggagtcaaaagaaaagagaaaagattggatttatgtggtg
gctggaatactaactgcccttattattgttgcaataggctggctaatattttataatgct
attgggaaaagcttgacttatcaagaaaatgacattacaatgccagaccttgtaggtttt
tcaattgatgatgcaaaggcaaaacttgatgagctgggactaaaatattcggttgaagag
caaaacgacccggctgaaaaaggaatggttatcaatcaagaccctgctgcaggtattaaa
gtaaaaaaagatactactgtcaagctaatagttagcaaaggaccggaaatggtcaaagtt
cctgatgtggttgggctcaatatcaaagatgctcagatagagcttgataacaatggtttg
agtgttgagataaagaaagattattctgacaagccggtggatacagttattgatcaacag
ccttctgcaaaccagctcatagagaaaaatggtactgtaattttgactgtaagtttgggt
cccaaaatagaaaaagtattagttccagatgtaacaggaatgaatatagttgatgccaag
gatgttttactaaaaaacggacttaacgccggtaacgttacttataaagaggtcacagat
agagagtctgatattgttatcagtcaatcaccatcttacgggcagcaggttgtaaaagga
agtactgttgatttaatagtgaccaaaaaggttgagacaaaaactacaacaaagattatt
ataaaaacagtaattttaccttctgatttaaatgaagcaaatgttaaaatagtggtaagt
tcaaacggaaatgagagcattgtatttgatagaatagtaaaaaaagaagagactccttta
caggttaaaattcctatcactggacaatctacaattaggatgtatataaacgaccaatta
tcaacagaggagacggtggaatag

DBGET integrated database retrieval system