KEGG   Citrobacter koseri: CKO_00536Help
Entry
CKO_00536         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cko  Citrobacter koseri
Pathway
cko00564  Glycerophospholipid metabolism
cko01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CKO_00536
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CKO_00536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 Lycopene_cycl Pyr_redox_3 FtsA Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: ABV11692
UniProt: A8ADX9
LinkDB All DBs
Position
complement(516261..517889)
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQTSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDELSFQATFIRACEEAGIRAEA
IDPQQARLIEPAVNPQLIGAVKVPDGTVDPFRLTAANMLDAREHGAIILTAHEVTGLIRE
GATICGVNVHNHLTGESQSLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAARDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCVTAQTALPGSQEPTENTLKRVISLPAPLRGSAVYRHGDRTP
AWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSAFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaaacaagtgacgtgattatcattggtgggggagccacaggc
gcagggatcgcccgagactgtgcgctacgcggattgcgcgttatcttagttgagcgccac
gatatcgcgaccggcgcaaccggccgtaaccacggcctgctgcatagcggcgcacgctat
gccgttaccgacgcggaatctgcccgcgaatgcatcagcgaaaaccagattctgaaacgg
atcgcccgccactgcgttgagccaacggacggtctgttcattaccttgccggaagacgaa
ttatccttccaggccacctttattcgcgcctgcgaagaggcgggtattcgcgccgaagca
attgatccgcaacaggcgcggctgatcgaaccggccgtcaatccgcagctgattggcgcg
gtgaaagtgcctgacggcactgtcgatcccttccggctgaccgccgcgaatatgctggat
gccagagaacatggcgcaatcattttaacggcgcatgaagtcaccggacttattcgcgaa
ggcgcgaccatttgcggcgtgaacgtgcataaccatctcacaggggaaagccaatcgctg
catgcgccggtcgtggtgaatgccgcaggcatctggggtcagcgaattgcggaatacgcc
gatctgagcatccgcatgttcccggcgaaagggtcgctgctgattatggatcatcgcatt
aaccagcatgtgattaaccgctgccgcaagccgtccgacgccgatattctggtgcccggc
gataccatctcgctcatcggcaccacatcgacccacattgactacaacgagatcgacagc
aaccgcgtcaccgcagaagaggttgatattctgctgcgtgaaggggaaaaactggcgccg
gtgatggcgaaaacgcgcattttgcgcgcctactcgggcgtgcgtccgctggtcgccagc
gatgacgatccgagcggtcgtaatgtcagccgcggcattgtgctgtttgaccatgctgca
cgcgacgggctggacgggtttatcaccattacgggcggtaagctgatgacctaccgcctg
atggcggaatgggcaaccgacgcggtatgccgaaaactgggcaacactcgcccctgcgtc
accgcgcaaaccgcccttcccggctcgcaggaacccacggaaaacacgcttaaacgcgtg
atctcgctgcccgccccgctacgcggttccgccgtctatcgtcacggcgatcgtactccg
gcctggctcagcgaaggtcgccagcaccgcagcctggtctgtgaatgcgaagcggtcacc
gcaggcgaagtgcagtacgccgtcgaaaatttaaccgtcaacagcctgctggatctgcgc
cgccgtacccgcgtaggcatgggcacatgtcagggagaactgtgcgcctgccgcgccgcc
gggctgctgcaacgttttaatgtcactaccgccgctcagtccatcactcagctttctgcg
ttcctcaatgaacgctggaaaggcgtacagcctgtcgcctggggagacgcgctgcgcgaa
agcgagttcacgcgctgggtttatcagggattgtgcggtctggagaaggagcaccaggat
gaaatttga

DBGET integrated database retrieval system